DN135233

Overview
NameDN135233
Unique NameDN135233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135233_ssr641 microsatellite DN135233_ssr641:641..652. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13714 contig Csv1_Contig13714:422..1128. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 5.680e-55
Identity = 103/158 (65.19%), Postives = 123/158 (77.85%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSL+PS FGGRRTNVFDP SLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+          G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++ISG
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.280e-54
Identity = 106/160 (66.25%), Postives = 124/160 (77.50%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPSIFGGRR+NVFDP S D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+            +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV             +I+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 6.280e-54
Identity = 107/159 (67.30%), Postives = 123/159 (77.36%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPSIFGGRRTNVFDP SLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR          G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+ISG
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.677e-52
Identity = 101/158 (63.92%), Postives = 118/158 (74.68%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MS+IPS FGGRR+NVFDP SLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT            AI+ISG
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.810e-51
Identity = 104/163 (63.80%), Postives = 119/163 (73.01%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIP+ FGGRR NVFDP SLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+           ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.225e-50
Identity = 102/159 (64.15%), Postives = 117/159 (73.58%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPSIFGGRR+NVFDP SLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+           R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.213e-50
Identity = 97/158 (61.39%), Postives = 116/158 (73.42%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPS FGGRR+NVFDP SLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++           R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT             I+ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.186e-50
Identity = 99/158 (62.66%), Postives = 115/158 (72.78%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPS F GRR+NVFDP SLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+           R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVLTVT            +IEISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.083e-49
Identity = 100/159 (62.89%), Postives = 116/159 (72.96%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIPS FGGRR++VFDP SLDVWDPF  F        PSS + E S F + R+DWKETP+AHVFKAD+PGL+          GR+LQISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVLTVT            AI+ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of DN135233 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.019e-48
Identity = 98/160 (61.25%), Postives = 114/160 (71.25%), Query Frame = 3
Query:   81 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 554
            MSLIP  FGGRR+NVFDP SLD+WDPF  F      + P+S+   E S F + R+DWKETP+AHVFKAD+PGL+           R+LQISGER+ E+E+KND WHRVERSSGKF RRFRLP+NAKV +VKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEISG 154          
The following BLAST results are available for this feature:
BLAST of DN135233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH5.680e-5565.1917.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH6.280e-5466.2518.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH6.280e-5467.3017.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA7.677e-5263.9217.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN3.810e-5163.8018.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN3.225e-5064.1517.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA4.213e-5061.3918.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA7.186e-5062.6618.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN6.083e-4962.8917.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN3.019e-4861.2517.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08c06 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08c06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135233 ID=DN135233|Name=DN135233|organism=Citrus sinensis|type=EST|length=708bp
TACGGCCGGGGANNTTCAATTGATTGATCAAAGCATTTCCGAAGTTGTTG
AGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTCCAAGCAT
CTTCGGTGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTAGATGTAT
GGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGCGCCGTCT
TCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACTGGAAAGA
GACTCCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTGAGGAAAG
AAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGATAAGCGGA
GAGAGGAGCAAGGAGCAGGAAGAGAAGAATGACAAGTGGCATCGCGTCGA
GAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGACAATGCTA
AGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCACAGTCACC
GTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTGAGATCTC
TGGCTAAGTGATAACTGTAAATGTTTTCAAGATAGTGTCTTTGGTTTGCT
AATAAATTTGGTACGAAAGCAAAGCCCTTGTGTGTTTGTATGTGTGTGTG
TGTTTGTTTTCTTCCCTTCCCCCTGTTTAATTTGATGTGATTATGTTTGT
GTGTTTGC
back to top