DN135232

Overview
NameDN135232
Unique NameDN135232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length668
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5724 contig Csv1_Contig5724:406..1073. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_XENLA (APAF1-interacting protein homolog OS=Xenopus laevis GN=apip PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.895e-34
Identity = 77/142 (54.23%), Postives = 94/142 (66.20%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIK---GHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPT 418
            PLFM AY  RDA AVIH+H   + + T++ P  KEF ITH EMIKGIK     GYY   D L VPI+ENT  E +L + +A+A+  YP   AVLVR HG+YVWGD+W  AKT  ECY YLFD A+++ Q GLD   P+  PT
Sbjct:   96 PLFMNAYTMRDAGAVIHTHSKAAVMATLMFP-GKEFLITHQEMIKGIKKGTSGGYYRYNDMLAVPIVENTPEEKDLKERMARAMTEYPDTCAVLVRRHGVYVWGDTWEKAKTMCECYDYLFDIAVQMKQHGLD---PSAVPT 233          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_HUMAN (APAF1-interacting protein OS=Homo sapiens GN=APIP PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.895e-34
Identity = 79/155 (50.97%), Postives = 100/155 (64.52%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIK---GHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLGLGSNGNV 457
            PLFM AY  R A AVIH+H   + + T++ P  +EF+ITH EMIKGIK     GYY   D LVVPIIENT  E +L D +A A++ YP + AVLVR HG+YVWG++W  AKT  ECY YLFD A+ + ++GLD S          +L +G NG V
Sbjct:   99 PLFMNAYTMRGAGAVIHTHSKAAVMATLLFP-GREFKITHQEMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPS----------QLPVGENGIV 242          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_DANRE (APAF1-interacting protein homolog OS=Danio rerio GN=apip PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.781e-34
Identity = 77/142 (54.23%), Postives = 96/142 (67.61%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGI-KGHG-----YYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPT 418
            P FM AY  R A AVIH+H   + + T++ P  KEFRITH EMIKGI KG+      Y D LVVPIIENT  E +L + +A+A+D YP + AVLVR HG+YVWG++W  AKT  ECY YLFD A+++ Q GLD   P+  PT
Sbjct:   98 PPFMNAYTMRGAQAVIHTHSKSAVMATLLFP-GKEFRITHQEMIKGIRKGNSGTNFRYDDTLVVPIIENTPEEKDLKERMARAMDMYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVQMKQSGLD---PSAFPT 235          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_XENTR (APAF1-interacting protein homolog OS=Xenopus tropicalis GN=apip PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.100e-33
Identity = 73/133 (54.89%), Postives = 90/133 (67.67%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIK---GHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLD 391
            PLFM AY  RDA AVIH+H   + + T++ P  KEF ITH EMIKGIK     GYY   D L VPI+ENT  E +L + +A+A+  YP   AVLVR HG+YVWGD+W  AKT  ECY YLF+ A+++ Q GLD
Sbjct:   96 PLFMNAYTMRDAGAVIHTHSKAAVMATLMFP-GKEFLITHQEMIKGIKKGTSGGYYRYDDMLAVPIVENTPEEKDLKERMARAMTEYPDTCAVLVRRHGVYVWGDTWEKAKTMCECYDYLFEIAVQMKQHGLD 227          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_CHICK (APAF1-interacting protein homolog OS=Gallus gallus GN=APIP PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.100e-33
Identity = 73/133 (54.89%), Postives = 91/133 (68.42%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIK---GHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLD 391
            PLFM AY  R A AVIH+H   + + T++ P   EF ITH EMIKGI+     GYY   D LVVPIIENT  E +L + +AKA++ YP + AVLVR HG+YVWG++W  AKT  ECY YLFD A+++ Q GLD
Sbjct:   99 PLFMNAYTMRGAGAVIHTHSKAAVMATLLYP-GNEFTITHQEMIKGIQKCSSGGYYRYDDTLVVPIIENTPEEKDLKERMAKAMEEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVQMKQHGLD 230          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: APIP_MOUSE (APAF1-interacting protein OS=Mus musculus GN=Apip PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.437e-33
Identity = 78/155 (50.32%), Postives = 101/155 (65.16%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIK---GHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGLDWSTPNHGPTRNFKLGLGSNGNV 457
            PLFM AY  R A AVIH+H   + + T++ P  +EF+ITH EMIKGI+     GYY   D LVVPIIENT  E +L + +A A++ YP + AVLVR HG+YVWG++W  AKT  ECY YLFD A+ + ++GLD       PT   +L +G NG V
Sbjct:   98 PLFMNAYTMRGAGAVIHTHSKAAVMATLLFP-GQEFKITHQEMIKGIRKCTSGGYYRYDDMLVVPIIENTPEEKDLKERMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKMGLD-------PT---QLPVGENGIV 241          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: YJZ4_YEAST (Putative aldolase class 2 protein YJR024C OS=Saccharomyces cerevisiae GN=YJR024C PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.660e-22
Identity = 54/138 (39.13%), Postives = 80/138 (57.97%), Query Frame = 2
Query:   11 PLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIKGH------------GYYDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQLGL 388
            PLF+  Y+K++A A+IH+H   + + +++     EFRI ++E IK I                ++D L +PIIEN A+E+EL D L K    YP   AV+VR HGI+VWG +   AK   E   YL + AIK++Q+G+
Sbjct:   91 PLFLACYQKKNAGAIIHTHSQNAVICSLL--FGDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGI 226          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: YK95_SCHPO (Putative aldolase class 2 protein C20H4.05c OS=Schizosaccharomyces pombe GN=SPAC20H4.05c PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.671e-21
Identity = 53/132 (40.15%), Postives = 81/132 (61.36%), Query Frame = 2
Query:   11 PLFMKAYEK-RDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMI----KGIKGHGYY---DELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQL 382
            PLF+  Y   RDA A IH+H  ++ L++ +   S  F  T  E++    KG K +G++   D++ +P I NTA+E++L DSL +AI+ YP   AV+VR+HGIY WGD+W + K   E   +LF A ++  +L
Sbjct:   86 PLFLAVYTSLRDAYACIHTHSQEAILLSTLFADSDHFSATGFEVLSYIPKGSKNNGFHKPTDKIKIPFINNTAHESDLHDSLQEAINLYPDTCAVIVRDHGIYCWGDTWQDTKMNTEAVEFLFQAYLRRRRL 217          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: YFY6_SCHPO (Putative aldolase class 2 protein C9.06c OS=Schizosaccharomyces pombe GN=SPAC9.06c PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 6.065e-16
Identity = 54/132 (40.91%), Postives = 71/132 (53.79%), Query Frame = 2
Query:    8 APLFMKAYEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGI-KGH---GY---YDELVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKLHQL 382
            A +F       DA A I+S  + +   +M N   ++F     EMIKGI KG+   GY   +D L VPII N      + D L K I+ YP+  AVL+R HG+  WG +W  +KTQ ECY YLF+   KL  L
Sbjct:   73 AYIFSWVLSNMDAVACIYSTSVAAVGASMYN---EKFTTQSKEMIKGIPKGNPSAGYLCCFDTLEVPIIHN-GDSKTILDELKKVIELYPQTCAVLIRGHGVIGWGATWEKSKTQMECYEYLFELDYKLKTL 200          
BLAST of DN135232 vs. ExPASy Swiss-Prot
Match: MTNB_BACP2 (Methylthioribulose-1-phosphate dehydratase OS=Bacillus pumilus (strain SAFR-032) GN=mtnB PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.184e-11
Identity = 42/118 (35.59%), Postives = 64/118 (54.24%), Query Frame = 2
Query:   29 YEKRDAXAVIHSHGIKSCLVTMINPMSKEFRITHMEMIKGIKGHGYYDE---LVVPIIENTAYENELTDSLAKAIDAYPKATAVLVRNHGIYVWGDSWINAKTQAECYHYLFDAAIKL 373
            YE+ +A   +H H I + +++ +     E R    E+IK +   GY++E   + +PIIEN A+   L    AK +    ++ AVL+RNHGI VWG +   AK   E Y +LF   +KL
Sbjct:   89 YERTNAGCCLHVHTIDNNVISELYGDKGEIRFKGNEIIKAL---GYWEEDAEVSLPIIENPAHIPHLAAQFAKHLTEESESGAVLIRNHGITVWGKTASEAKRVLEAYEFLFSYYLKL 203          
The following BLAST results are available for this feature:
BLAST of DN135232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
APIP_XENLA2.895e-3454.23APAF1-interacting protein homolog OS=Xenopus laevi... [more]
APIP_HUMAN2.895e-3450.97APAF1-interacting protein OS=Homo sapiens GN=APIP ... [more]
APIP_DANRE3.781e-3454.23APAF1-interacting protein homolog OS=Danio rerio G... [more]
APIP_XENTR1.100e-3354.89APAF1-interacting protein homolog OS=Xenopus tropi... [more]
APIP_CHICK1.100e-3354.89APAF1-interacting protein homolog OS=Gallus gallus... [more]
APIP_MOUSE1.437e-3350.32APAF1-interacting protein OS=Mus musculus GN=Apip ... [more]
YJZ4_YEAST9.660e-2239.13Putative aldolase class 2 protein YJR024C OS=Sacch... [more]
YK95_SCHPO3.671e-2140.15Putative aldolase class 2 protein C20H4.05c OS=Sch... [more]
YFY6_SCHPO6.065e-1640.91Putative aldolase class 2 protein C9.06c OS=Schizo... [more]
MTNB_BACP21.184e-1135.59Methylthioribulose-1-phosphate dehydratase OS=Baci... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08c05 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08c05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135232 ID=DN135232|Name=DN135232|organism=Citrus sinensis|type=EST|length=668bp
CCGGGGTGCTCCTCTTTTCATGAAGGCATACGAGAAACGTGATGCAGNCG
CTGTTATCCACAGCCATGGCATAAAATCTTGCCTTGTGACAATGATCAAT
CCAATGTCAAAAGAATTTCGTATAACTCACATGGAGATGATAAAAGGAAT
CAAAGGGCATGGTTACTATGATGAACTCGTTGTTCCAATTATAGAGAACA
CAGCTTATGAAAATGAGCTCACTGATTCTCTTGCTAAAGCGATAGATGCC
TATCCAAAAGCAACAGCTGTGCTTGTTCGTAATCATGGCATATATGTTTG
GGGAGACTCCTGGATCAATGCTAAAACTCAGGCTGAATGTTATCACTATC
TCTTTGATGCTGCTATCAAACTCCATCAACTGGGCCTGGACTGGTCTACT
CCAAACCATGGTCCAACTCGTAATTTTAAGTTAGGTTTAGGAAGCAATGG
CAATGTAAATACATCTGCAAAAGCAGTGACTGAAGGCTCAAATTATGGTT
CTGGCCTATTCCCACGTTGCATTGTACTTGACATTGAAGGGACTACCACT
CCCATATCATTTGTTTCTGAGGTTCTCTTTCCATATGCTCGTGACAATGT
TGGGAAGCATTTGTCTGTGACATATGATACTCNNNNAACTCAAGATGANN
TCAAGTTTGTTGCGCTCT
back to top