DN135231

Overview
NameDN135231
Unique NameDN135231
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length638
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135231_ssr5 microsatellite DN135231_ssr5:5..19. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2614 contig Csv1_Contig2614:125..763. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.242e-23
Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.210e-19
Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 2
Query:   92 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 283
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.203e-18
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 277
            MSD CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.920e-16
Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 277
            MS  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.276e-16
Identity = 39/66 (59.09%), Postives = 46/66 (69.70%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.245e-15
Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.245e-15
Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.165e-13
Identity = 33/66 (50.00%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MSD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DN135231 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.427e-13
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   83 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            MSD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DN135231 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA1.242e-2369.70Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC9.210e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE1.203e-1867.69Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV1.920e-1658.46Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO3.276e-1659.09Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ1.245e-1554.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI1.245e-1554.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ1.165e-1350.00Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI4.427e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08c04 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08c04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135231 ID=DN135231|Name=DN135231|organism=Citrus sinensis|type=EST|length=638bp
TCACAGCAAAGCAAAGCAAGTTTCGTACAATAAAGAGCCCTCTATTTCCA
GTTTTAAATTCCAAGTTCTAAGCTCAATCAACATGTCGGACACCTGCGGC
AACTGCGACTGCGCTGACAGGAGCCAGTGTGTGAAGAAGGGAAGCAGCTA
TGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCACCGTTGTTG
TCATGGACGTTCAGGCTGCTGAGACTGAAGGTAACTGCAAGTGCGGCCCC
ACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTAATAAGCAAACAC
ATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTATATATTGTGGGGGTT
AAGAATAATGTAAGGGTGATTAAAAAAAAAGAAAAATTCTCTACTTCGTT
TTTATGATGGTCTACTACTAGTGTGTGGAGTGATGTGCGTGTTGTGTCAC
CCATCACTCGTAATGTTTTGTGTTTCCTTCTTCATAATCATGTAATATAT
GGCCATGGCCATGACCGTGGCCTTGTGTGGTTTAATTTTAATGTATTATT
GTTAGTCCACAANAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAGGAAAAAAAAAAAAAAAAAAAAAAAA
back to top