DN135227

Overview
NameDN135227
Unique NameDN135227
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length573
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DN135227 vs. ExPASy Swiss-Prot
Match: VATG_CITLI (V-type proton ATPase subunit G OS=Citrus limon GN=VATG PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.019e-24
Identity = 56/59 (94.92%), Postives = 57/59 (96.61%), Query Frame = 2
Query:  185 QVEREFQRKLAESSGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQVLLKHVTTVKN 361
            QVEREFQRKLAES GDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQ+ LKHVTTVKN
Sbjct:   52 QVEREFQRKLAESVGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQMFLKHVTTVKN 110          
BLAST of DN135227 vs. ExPASy Swiss-Prot
Match: VATG1_TOBAC (V-type proton ATPase subunit G 1 OS=Nicotiana tabacum GN=VATG1 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.324e-17
Identity = 42/58 (72.41%), Postives = 50/58 (86.21%), Query Frame = 2
Query:  188 VEREFQRKLAESSGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQVLLKHVTTVKN 361
            +E EFQRKL ++SGDSGANVKRLEQET+ KI HLK  AE++  DVVQ+LL+HVTTVKN
Sbjct:   53 MEAEFQRKLEQTSGDSGANVKRLEQETDAKIEHLKTEAERVSPDVVQMLLRHVTTVKN 110          
BLAST of DN135227 vs. ExPASy Swiss-Prot
Match: VAGT1_ARATH (V-type proton ATPase subunit G1 OS=Arabidopsis thaliana GN=VHA-G1 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.451e-16
Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  185 QVEREFQRKLAESSGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQVLLKHVTTVKN 361
            Q E++FQRKL E+SGDSGANVKRLEQET+ KI  LK  A +I  DVV++LLKHVTTVKN
Sbjct:   52 QTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLLKHVTTVKN 110          
BLAST of DN135227 vs. ExPASy Swiss-Prot
Match: VATG2_TOBAC (V-type proton ATPase subunit G 2 OS=Nicotiana tabacum GN=VATG2 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.983e-15
Identity = 40/58 (68.97%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  188 VEREFQRKLAESSGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQVLLKHVTTVKN 361
            +E EFQR + ++SGDSGANVKRLEQET  KI HLK  AE I +DVVQ+LL+ VTTVKN
Sbjct:   54 MEAEFQRNVEQTSGDSGANVKRLEQETFAKIQHLKTEAESISHDVVQMLLRQVTTVKN 111          
BLAST of DN135227 vs. ExPASy Swiss-Prot
Match: VATG2_ARATH (V-type proton ATPase subunit G2 OS=Arabidopsis thaliana GN=VHA-G2 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.039e-12
Identity = 38/57 (66.67%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  191 EREFQRKLAESSGDSGANVKRLEQETEVKIHHLKAGAEKIQYDVVQVLLKHVTTVKN 361
            E+ FQRKL  +SGDSGANVKRLEQET+ KI  LK  A +I  DVV +LLK+VTTV N
Sbjct:   50 EQGFQRKLEATSGDSGANVKRLEQETDAKIEQLKNEATRISKDVVDMLLKNVTTVNN 106          
The following BLAST results are available for this feature:
BLAST of DN135227 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
VATG_CITLI2.019e-2494.92V-type proton ATPase subunit G OS=Citrus limon GN=... [more]
VATG1_TOBAC5.324e-1772.41V-type proton ATPase subunit G 1 OS=Nicotiana taba... [more]
VAGT1_ARATH3.451e-1671.19V-type proton ATPase subunit G1 OS=Arabidopsis tha... [more]
VATG2_TOBAC4.983e-1568.97V-type proton ATPase subunit G 2 OS=Nicotiana taba... [more]
VATG2_ARATH1.039e-1266.67V-type proton ATPase subunit G2 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08b11 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08b11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135227 ID=DN135227|Name=DN135227|organism=Citrus sinensis|type=EST|length=573bp
CCGGGGCTTCTTCCCCTAATAATAATACCATTAGATTGGCGAAGAAAAGG
TCTCTGTTGTTCCCCCGCTTTTCACTGAATCTTGGCCGCAAGCAAGTCTC
AACAGGAAAGCATGGCATCTAATCGGGGTCATGGTGGAATTCAGCAAAGA
AGAGGCTGAAAGGGAGATTGCTGAACATCGAGCTCAGGTGGAGCGTGAGT
TCCAGAGGAAACTTGCAGAGAGTAGTGGAGATTCAGGTGCGAATGTGAAG
AGGCTTGAACAAGAAACAGAGGTAAAAATTCATCATCTGAAGGCTGGGGC
TGAGAAAATTCAATATGATGTTGTCCAAGTGCTCCTCAAGCATGTTACAA
CTGTGAAGAATTAAGCTCTGATGTTATCTTTTCCTGGTTCGTTGTGAATC
CTAGACTTCATGTGAGTTGTAATTAGGATCCATGCATTGGTTGTTTCATC
GTTTGGTTTATTTTGGATTGTAATTTATCAAAGTTGGAAATGAGTTCGTT
GTACTTCAAATTCTGCTCATTGTTAGAATAAATAACCATAAGTAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA
back to top