DN135221

Overview
NameDN135221
Unique NameDN135221
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length276
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK3_VITVI (S-adenosylmethionine synthetase 3 OS=Vitis vinifera GN=METK3 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.951e-43
Identity = 82/91 (90.11%), Postives = 89/91 (97.80%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC+KTNMVMVFGEITTKAKVDY+K+VRDTCRGIGFVSADVGLDAD CKVLVNIE+QSP+IAQ VHG+LSK+PEEIG
Sbjct:   29 DACLEQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK2_TOBAC (S-adenosylmethionine synthetase 2 OS=Nicotiana tabacum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.157e-42
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKAKVDY+K+VRDTCRGIGF SADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK1_VITVI (S-adenosylmethionine synthetase 1 OS=Vitis vinifera GN=METK1 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.157e-42
Identity = 80/91 (87.91%), Postives = 88/91 (96.70%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKAKV+Y+K+VRDTCRGIGFVSADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK3_SOLLC (S-adenosylmethionine synthetase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.817e-42
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKA VDY+K+VRDTCRGIGFVSADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK1_PICSI (S-adenosylmethionine synthetase 1 OS=Picea sitchensis GN=METK1 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.678e-42
Identity = 78/91 (85.71%), Postives = 87/91 (95.60%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVM+FGEITTKA +DY+K+VRDTCRGIGFVSADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMIFGEITTKANIDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK1_TOBAC (S-adenosylmethionine synthetase 1 OS=Nicotiana tabacum GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.195e-42
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKA VDY+K+VRDTCRGIGF SADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK1_PETHY (S-adenosylmethionine synthetase 1 OS=Petunia hybrida GN=SAM1 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.070e-41
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKA VDY+K+VRDTCRGIGF SADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK2_ACTCH (S-adenosylmethionine synthetase 2 OS=Actinidia chinensis GN=SAM2 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.398e-41
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKAKV+Y+K+VRDTCRGIGF S DVGLDAD CKVLVNIE+QSP+IAQ VHG+LSK+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFTSPDVGLDADHCKVLVNIEQQSPDIAQGVHGHLSKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK4_POPTR (S-adenosylmethionine synthetase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.384e-41
Identity = 78/91 (85.71%), Postives = 86/91 (94.51%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACL QDPESKVACETC+KTNMVMVFGEITTKA VDY+K+VRDTCRGIGF SADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLAQDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of DN135221 vs. ExPASy Swiss-Prot
Match: METK2_SOLTU (S-adenosylmethionine synthetase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.384e-41
Identity = 78/91 (85.71%), Postives = 86/91 (94.51%), Query Frame = 2
Query:    2 DACLEQDPESKVACETCAKTNMVMVFGEITTKAKVDYKKVVRDTCRGIGFVSADVGLDADKCKVLVNIEKQSPEIAQSVHGNLSKRPEEIG 274
            DACLEQDPESKVACETC KTNMVMVFGEITTKA VDY+K+VRDTCR IGF+SADVGLDAD CKVLVNIE+QSP+IAQ VHG+L+K+PEEIG
Sbjct:   29 DACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFISADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
The following BLAST results are available for this feature:
BLAST of DN135221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_VITVI1.951e-4390.11S-adenosylmethionine synthetase 3 OS=Vitis vinifer... [more]
METK2_TOBAC2.157e-4287.91S-adenosylmethionine synthetase 2 OS=Nicotiana tab... [more]
METK1_VITVI2.157e-4287.91S-adenosylmethionine synthetase 1 OS=Vitis vinifer... [more]
METK3_SOLLC2.817e-4287.91S-adenosylmethionine synthetase 3 OS=Solanum lycop... [more]
METK1_PICSI3.678e-4285.71S-adenosylmethionine synthetase 1 OS=Picea sitchen... [more]
METK1_TOBAC8.195e-4286.81S-adenosylmethionine synthetase 1 OS=Nicotiana tab... [more]
METK1_PETHY1.070e-4186.81S-adenosylmethionine synthetase 1 OS=Petunia hybri... [more]
METK2_ACTCH1.398e-4186.81S-adenosylmethionine synthetase 2 OS=Actinidia chi... [more]
METK4_POPTR2.384e-4185.71S-adenosylmethionine synthetase 4 OS=Populus trich... [more]
METK2_SOLTU2.384e-4185.71S-adenosylmethionine synthetase 2 OS=Solanum tuber... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08b01 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08b01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135221 ID=DN135221|Name=DN135221|organism=Citrus sinensis|type=EST|length=276bp
GGATGCTTGTCTGGAACAAGACCCGGAGAGTAAAGTTGCTTGTGAGACCT
GTGCTAAAACAAATATGGTTATGGTCTTTGGTGAGATAACAACCAAGGCC
AAAGTGGATTACAAAAAGGTTGTTCGTGACACTTGCAGAGGCATTGGATT
TGTCTCAGCTGATGTTGGACTTGATGCCGATAAGTGCAAGGTCCTCGTCA
ATATTGAAAAGCAAAGCCCTGAAATTGCTCAAAGTGTTCATGGCAACTTG
AGCAAGAGGCCTGAGGAAATTGGTGC
back to top