DN135218

Overview
NameDN135218
Unique NameDN135218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5702 contig Csv1_Contig5702:1..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_ARATH (Beta-amylase OS=Arabidopsis thaliana GN=BMY1 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.896e-68
Identity = 119/221 (53.85%), Postives = 159/221 (71.95%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WV +    +PD+ YT++ G R+ EY+S+G D +PL  GRT +Q+YSDYM SF++   D +   V+ +I+VGLGP GELRYP+YP+S G W FPGIGEFQCYDKY++   K +A  + + +W    P D+G+YN  PE+TGFF++DGT+ SE G+FFM WYS KLI HGD+IL  A +IF G    L+ KV+GIHW Y   SHAAELTAGYYN
Sbjct:  104 DIVTIPIPQWVRDVGDNDPDIYYTNRKGTRDIEYLSIGVDNLPLFAGRTAVQLYSDYMSSFKENMADLIEAGVIVDIEVGLGPAGELRYPSYPQSQG-WVFPGIGEFQCYDKYLKKDFKEAAAKAGHPEWDL--PEDAGEYNDKPEETGFFKKDGTYVSEKGKFFMTWYSNKLIFHGDQILGEANKIFAGLKVNLAAKVSGIHWLYNHHSHAAELTAGYYN 321          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_MEDSA (Beta-amylase OS=Medicago sativa GN=BMY1 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.515e-68
Identity = 119/221 (53.85%), Postives = 163/221 (73.76%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IPLP WVL+    +PD+ YT++SG RN EY+S+G D  P+  GRT I++YSDYM+SFR+   D L  +V+ +I+VGLGP GELRYP+YP++ G W+FPGIGEFQCYDKY+R S KA+A  + + +W    P D+G YN  PE T FF+ +GT+ +E G+FF+ WYS +L+ HGD+IL  A + F G   KL+ KV+GIHW Y++ +HAAELTAGYYN
Sbjct:  102 DVVNIPLPKWVLDIGESDPDIFYTNRSGIRNQEYLSIGVDNKPIFHGRTAIEIYSDYMKSFRENMSDLLKSEVIIDIEVGLGPAGELRYPSYPQNQG-WQFPGIGEFQCYDKYLRESFKAAAAKAGHSEWEL--PDDAGTYNDVPESTEFFKTNGTYLTEKGKFFLTWYSNQLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKAPNHAAELTAGYYN 319          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_SOYBN (Beta-amylase OS=Glycine max GN=BMY1 PE=1 SV=3)

HSP 1 Score: 253.832 bits (647), Expect = 6.098e-67
Identity = 116/221 (52.49%), Postives = 161/221 (72.85%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WVL+    N D+ YT++SG RN EY+++G D  P+  GRT I++YSDYM+SFR+   D+L   ++ +I+VGLGP GELRYP+YP+S G W+FP IGEFQCYDKY++A  KA+   + + +W    P D+G+YN  PE TGFF+ +GT+ +E G+FF+ WYS KL+ HGD+IL  A + F G   KL+ KV+GIHW Y+  +HAAELTAGYYN
Sbjct:  102 DIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVGLGPAGELRYPSYPQSQG-WEFPRIGEFQCYDKYLKADFKAAVARAGHPEWEL--PDDAGKYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTAGYYN 319          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_HORVU (Beta-amylase OS=Hordeum vulgare GN=BMY1 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.964e-67
Identity = 119/218 (54.59%), Postives = 160/218 (73.39%), Query Frame = 1
Query:   34 SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            +IP+P WV +  +++PD+ YTD  G RN EY++LG D  PL  GR+ +Q+Y+DYM SFR+  +D+L   V+ +I+VGLGP GE+RYP+YP+S+G W FPGIGEF CYDKY++A  KA+A A  + +W    P+D GQYN  PE T FF+ +GT+ SE GRFF+ WYS  LI+HGDRIL  A ++F G   +L+ K++GIHW Y+  SHAAELTAGYYN
Sbjct:  102 NIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGEMRYPSYPQSHG-WSFPGIGEFICYDKYLQADFKAAAAAVGHPEW--EFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYN 316          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_VIGUN (Beta-amylase OS=Vigna unguiculata GN=BMY1 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.040e-66
Identity = 115/221 (52.04%), Postives = 162/221 (73.30%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WVL+    +PD+ YT++SG R+ EY+++G D  P+  GRT I+VYSDYM+SFR+   D+L  +V+ +I+VGLGP GELRYP+YP++ G W FPGIGEFQCYDKY++A  KA+A  + + +W    P D+G YN  PE T FF+ +GT+ +E G+FF+ WYS +L+ HGD IL  A + F G    L+ KV+GIHW Y++++HAAELTAGYYN
Sbjct:  102 DVVNIPIPQWVLDIGESDPDIFYTNRSGTRDKEYLTIGVDNKPIFHGRTAIEVYSDYMKSFRENMSDFLKSEVIIDIEVGLGPAGELRYPSYPQNQG-WVFPGIGEFQCYDKYLKAEFKAAAARAGHSEWEL--PDDAGTYNDVPESTEFFKTNGTYLTEKGKFFLTWYSNQLLNHGDEILDEANKAFLGCKVNLAIKVSGIHWWYKAQNHAAELTAGYYN 319          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_TRIRP (Beta-amylase OS=Trifolium repens GN=BMY1 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.774e-66
Identity = 113/221 (51.13%), Postives = 164/221 (74.21%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WVL+    +PD+ YT++SG R+ EY+++G D  P+  GRT I++YSDYM+SFR+   ++L  +++ +I+VGLGP GELRYP+YP++ G W FPGIGEFQCYDKY++A  KA+A  + + +W    P D+G YN  PE T FF+ +GT+ +E G+FF+ WYS +L+ HGD+IL  A + F G   KL+ KV+GIHW Y++++HAAELTAGYYN
Sbjct:  102 DVVTIPIPQWVLDIGESDPDIFYTNRSGTRDKEYLTVGVDNKPIFHGRTAIEIYSDYMKSFRENMSEFLKSELIIDIEVGLGPAGELRYPSYPQNQG-WVFPGIGEFQCYDKYLKADFKAAAAKAGHSEWEL--PDDAGTYNDIPESTEFFKTNGTYLTEKGKFFLTWYSNQLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKAQNHAAELTAGYYN 319          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_HORSP (Beta-amylase OS=Hordeum spontaneum GN=BMY1 PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.317e-66
Identity = 117/218 (53.67%), Postives = 161/218 (73.85%), Query Frame = 1
Query:   34 SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            +IP+P WV +  +++PD+ YTD  G RN EY++LG D  PL  GR+ +Q+Y+DYM SFR+  +++L   V+ +I+VGLGP GE+RYP+YP+S+G W FPGIGEF CYDKY++A  KA+A A  + +W    P+D+GQYN  PE T FF+ +GT+ +E GRFF+ WYS  LI+HGDRIL  A ++F G   +L+ K++GIHW Y+  SHAAELTAGYYN
Sbjct:  102 NIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHG-WSFPGIGEFICYDKYLQADFKAAAAAVGHPEW--EFPNDAGQYNDTPERTQFFRDNGTYLTEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYN 316          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_MAIZE (Beta-amylase OS=Zea mays GN=BMY1 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 7.454e-65
Identity = 116/221 (52.49%), Postives = 158/221 (71.49%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WV +    NPD+ YT++SG  N EY++LG D  PL  GRT IQ+Y+DYM+SFR+   D+L   VV +I+VGLGP GE+RYP+YP+S G W FPG+GEF CYDKY++A  KA+AE + + +W      D+G YN  PE T FF  +GT+ ++ G+FF+ WYS KLI+HGD+IL  A ++F G   +L+ KV+GIHW Y   +HAAELTAGYYN
Sbjct:   99 DVVNIPIPQWVRDVGKSNPDIFYTNRSGLTNIEYLTLGVDDQPLFHGRTAIQLYADYMKSFRENMADFLDAGVVVDIEVGLGPAGEMRYPSYPQSQG-WVFPGVGEFICYDKYLQADFKAAAEEAGHPEWDLLD--DAGTYNDTPEKTQFFADNGTYQTDKGKFFLTWYSNKLIKHGDKILDEANKVFLGCKVQLAIKVSGIHWWYNVPNHAAELTAGYYN 316          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_WHEAT (Beta-amylase OS=Triticum aestivum GN=BMY1 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.661e-64
Identity = 113/221 (51.13%), Postives = 159/221 (71.95%), Query Frame = 1
Query:   25 NMYSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL-GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            ++ +IP+P WV +  + +PD+ YT++ G RN EY++LG D  PL  GRT +Q+Y+DYM SFR+  + +L    + +I+VGLGP GE+RYP+YP+S G W FPGIGEF CYDKY+ A  KA+A  + + +W    P D+G+YN  PE T FF+ +GT+ +E G+FF+ WYS KLI+HGD+IL  A ++F G   +L+ K++GIHW YR  +HAAELTAGYYN
Sbjct:   99 DVVNIPIPQWVRDVGATDPDIFYTNRGGTRNIEYLTLGVDDQPLFHGRTAVQMYADYMASFRENMKKFLDAGTIVDIEVGLGPAGEMRYPSYPQSQG-WVFPGIGEFICYDKYLEADFKAAAAKAGHPEWEL--PDDAGEYNDTPEKTQFFKDNGTYLTEKGKFFLSWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWWYRVPNHAAELTAGYYN 316          
BLAST of DN135218 vs. ExPASy Swiss-Prot
Match: AMYB_IPOBA (Beta-amylase OS=Ipomoea batatas GN=BMY1 PE=1 SV=4)

HSP 1 Score: 242.662 bits (618), Expect = 1.406e-63
Identity = 114/218 (52.29%), Postives = 153/218 (70.18%), Query Frame = 1
Query:   37 IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRDRFRDYL--GDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASSNEDWGRSGPHDSGQYNQFPEDTGFFQRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYN 684
            IP+P W+L+   KNPD+ YT+++G RN EY+SLG D   L +GRT +++Y D+M SFRD   D+L  GD+V +I+VG G  GELRYP+YPE+ G W FPGIGEFQCYDKYM A  K + + + N DW   G   +G YN  P+ T FF+ +GT+ ++ G+FF+ WYS KLI HGD++L  A ++F G    ++ KV+GIHW Y   SHAAELTAG+YN
Sbjct:  107 IPIPQWILQIGDKNPDIFYTNRAGNRNQEYLSLGVDNQRLFQGRTALEMYRDFMESFRDNMADFLKAGDIV-DIEVGCGAAGELRYPSYPETQG-WVFPGIGEFQCYDKYMVADWKEAVKQAGNADWEMPGK-GAGTYNDTPDKTEFFRPNGTYKTDMGKFFLTWYSNKLIIHGDQVLEEANKVFVGLRVNIAAKVSGIHWWYNHVSHAAELTAGFYN 321          
The following BLAST results are available for this feature:
BLAST of DN135218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
AMYB_ARATH1.896e-6853.85Beta-amylase OS=Arabidopsis thaliana GN=BMY1 PE=2 ... [more]
AMYB_MEDSA5.515e-6853.85Beta-amylase OS=Medicago sativa GN=BMY1 PE=2 SV=1[more]
AMYB_SOYBN6.098e-6752.49Beta-amylase OS=Glycine max GN=BMY1 PE=1 SV=3[more]
AMYB_HORVU7.964e-6754.59Beta-amylase OS=Hordeum vulgare GN=BMY1 PE=1 SV=1[more]
AMYB_VIGUN1.040e-6652.04Beta-amylase OS=Vigna unguiculata GN=BMY1 PE=2 SV=... [more]
AMYB_TRIRP1.774e-6651.13Beta-amylase OS=Trifolium repens GN=BMY1 PE=2 SV=1[more]
AMYB_HORSP2.317e-6653.67Beta-amylase OS=Hordeum spontaneum GN=BMY1 PE=1 SV... [more]
AMYB_MAIZE7.454e-6552.49Beta-amylase OS=Zea mays GN=BMY1 PE=2 SV=1[more]
AMYB_WHEAT1.661e-6451.13Beta-amylase OS=Triticum aestivum GN=BMY1 PE=2 SV=... [more]
AMYB_IPOBA1.406e-6352.29Beta-amylase OS=Ipomoea batatas GN=BMY1 PE=1 SV=4[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08a07 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08a07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135218 ID=DN135218|Name=DN135218|organism=Citrus sinensis|type=EST|length=684bp
CCGGGGATCTACGGCTTTATGTTGAATATGTACAGTATTCCGCTACCTCC
ATGGGTGCTTGAAGAAATCAGCAAGAATCCTGACCTGGTGTACACAGACA
AGTCAGGGAGAAGGAATCCAGAGTACATCTCGTTGGGTTGTGATACAATA
CCGTTGCTCAGAGGAAGAACACCGATTCAGGTCTACTCAGATTACATGAG
GAGCTTCCGGGACAGATTCAGAGATTACTTGGGTGATGTTGTACAGGAAA
TTCAAGTGGGCTTGGGTCCTTGCGGGGAGCTGAGATACCCAGCTTATCCA
GAAAGCAATGGGACCTGGAAGTTTCCAGGGATTGGAGAATTCCAATGCTA
TGACAAGTATATGAGAGCTTCACTGAAAGCATCAGCAGAGGCATCTAGTA
ATGAGGACTGGGGAAGGAGTGGGCCTCATGATTCTGGCCAGTATAATCAA
TTTCCTGAAGATACAGGGTTTTTCCAGAGAGATGGTACCTGGAACTCTGA
GTATGGACGGTTCTTCATGGAATGGTACTCTGGAAAGCTAATACAACATG
GTGATCGAATTCTAGCAGCTGCCAAGGAAATATTCCAAGGAACTGGCTCA
AAACTCTCTGGAAAAGTAGCCGGAATTCACTGGCACTACAGATCGAGGTC
CCATGCGGCTGAATTGACAGCCGGATACTACAAT
back to top