DN135217

Overview
NameDN135217
Unique NameDN135217
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length681
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5701 contig Csv1_Contig5701:1..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135217 vs. ExPASy Swiss-Prot
Match: CHMU_ARATH (Chorismate mutase, chloroplastic OS=Arabidopsis thaliana GN=CM1 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 4.178e-44
Identity = 86/122 (70.49%), Postives = 100/122 (81.97%), Query Frame = 2
Query:  314 AATALIGSSKRKGRVDESENMKLEGIRKSLIRQEDSIIFSLLERAQYCINVDTYDPDAFTIDGQRCSLVEYILKETEKLHSKLGRYQSPDEHPFFPDQLPDPVLPPMQYPQVLHPIADSINI 679
            A   L GS   K RVDESE++ LEGIR SLIRQEDSIIF LLERA+YC N DTYDP AF +DG   SLVEY++K TEKLH+K+GR++SPDEHPFFPD LP+P+LPP+QYP+VLH  ADSINI
Sbjct:   60 AVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSINI 181          
BLAST of DN135217 vs. ExPASy Swiss-Prot
Match: CHMU_SCHPO (Probable chorismate mutase OS=Schizosaccharomyces pombe GN=SPAC16E8.04c PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.829e-15
Identity = 47/117 (40.17%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  365 SENMKLEGIRKSLIRQEDSIIFSLLERAQY-------------CINVDTYDPDAFTIDGQRCSLVEYILKETEKLHSKLGRYQSPDEHPFFPDQLPDPVLPPMQYPQVLHPIADSIN 676
            +E +KLE IR +LIRQED+IIF+ LERAQ+             C+N++ YD           S + Y+L E EK+++ + RY SP+E+P F D LP+P+LP       LHP   ++N
Sbjct:    5 NEKLKLENIRSALIRQEDTIIFNFLERAQFPRNEKVYKSGKEGCLNLENYDG----------SFLNYLLHEEEKVYALVRRYASPEEYP-FTDNLPEPILPKFSGKFPLHPNNVNVN 110          
BLAST of DN135217 vs. ExPASy Swiss-Prot
Match: CHMU_YEAST (Chorismate mutase OS=Saccharomyces cerevisiae GN=ARO7 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.120e-15
Identity = 39/103 (37.86%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  374 MKLEGIRKSLIRQEDSIIFSLLERAQYCINVDTYDPD--AFTIDGQRCSLVEYILKETEKLHSKLGRYQSPDEHPFFPDQLPDPVLPPMQYPQVLHPIADSIN 676
            + L+ IR  L+R EDSIIF  +ER+ +      Y+ +     I   + S +++ L   E  HS++ R++SPDE PFFPD++    LP + YPQ+L P A  +N
Sbjct:   10 LNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVN 112          
The following BLAST results are available for this feature:
BLAST of DN135217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CHMU_ARATH4.178e-4470.49Chorismate mutase, chloroplastic OS=Arabidopsis th... [more]
CHMU_SCHPO1.829e-1540.17Probable chorismate mutase OS=Schizosaccharomyces ... [more]
CHMU_YEAST3.120e-1537.86Chorismate mutase OS=Saccharomyces cerevisiae GN=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08a05 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08a05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135217 ID=DN135217|Name=DN135217|organism=Citrus sinensis|type=EST|length=681bp
TTGCGGTGTCCGTTCCCACTCGTGTTACCACCAACTCTTGAGCTTCTTCA
CCTACCCCTCGCCAATCAACCTTTTTTAGTTTTTGAAGCCCCCATTTGCA
TTTCATTCTCTCTATTCTTTGTAAAACGCTTTCTTTTCAATGGAGACCAA
GCTGTTGAGAGCCTCAGCCTCTTCTCCTACAATTCCAGGTCTTAATGCAT
CCAAGTTTTGGGGACCTAGTTGCCCTTTTACTCTCAAAACCAGACAGAGC
TCTGCCTCCACAGTTTTGTTTTGGAGTTTGCCAGTGAAACGCGTTCAACC
CGTTAATGCCATGGCTGCAACCGCTCTTATTGGGTCATCAAAAAGAAAGG
GAAGGGTCGATGAAAGTGAAAACATGAAACTGGAGGGCATAAGAAAATCA
TTAATTCGACAAGAGGATAGCATAATATTTAGCCTTTTAGAGAGAGCTCA
ATATTGTATTAATGTAGATACATATGATCCTGATGCTTTCACCATAGACG
GACAACGTTGCTCATTGGTGGAGTACATACTTAAAGAAACTGAAAAACTT
CACTCCAAGTTGGGCCGATACCAAAGCCCGGATGAGCATCCATTCTTTCC
TGATCAACTGCCTGACCCAGTGTTGCCACCTATGCAGTACCCACAGGTAC
TCCATCCCATAGCTGATTCAATCAATATAAA
back to top