DN135033

Overview
NameDN135033
Unique NameDN135033
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3577 contig Csv1_Contig3577:53..685. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135033 vs. ExPASy Swiss-Prot
Match: FCSA_DICDI (Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.476e-16
Identity = 48/136 (35.29%), Postives = 81/136 (59.56%), Query Frame = 3
Query:  195 WDVFRMAVERNPNNRMLGQREIV-DGKAGKYVWKTYKEVYDLVIKVVNAIRTCGVEERGKCGIYGVNCPEWIIGMEACNALGLHCVPLYDTLGAGAVEFIICHSGVSIAFVEEKKIPEMLKTFPKTTEHLKTIVSF 599
            +DV+R  + ++ ++  LG RE++ DGK G Y W +YK+       + +A+   G+ +  + GI+ +N PEW++   A     L  V LY TLGA A+E+++ HS +S+   E K + ++L + P TT  +KTIVS+
Sbjct:   57 YDVYR--INKDSDSNFLGIRELLADGKRGDYKWISYKQACIRANNIGSALVQLGLNKGDRIGIFSINRPEWVLSDMAAMNHSLVPVALYATLGANAIEYVVNHSEISVLLCEGKNVEKIL-SMPGTT--IKTIVSY 187          
BLAST of DN135033 vs. ExPASy Swiss-Prot
Match: ACSL1_CAVPO (Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.069e-11
Identity = 48/153 (31.37%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  183 MESCWDVFRMAVERNPNNRMLGQREIVDGKAGKYVWKTYKEVYDLVIKVVNAIRTCGVEERGK--CGIYGVNCPEWIIGMEACNALGLHCVPLYDTLGAGAVEFIICHSGVSIAFVEEKKIPEML--KTFPKTTEHLKTIVSFSKVKPEQREE 629
            + + +DVF+  ++ + N   LG R+        Y W +YK+V DL   + +A+   G +       GI+  N PEW+I  +AC A  +  VPLYDTLGA A+ +I+  + +S+ F ++ +   +L      K T  LK IV       E  E+
Sbjct:   89 VRTLYDVFQRGIQVSNNGPCLGSRK----PDQPYEWLSYKQVEDLSECIGSALLQKGFQASPDQFIGIFAQNRPEWVIIEQACFAYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKARILLESVENKLTPGLKIIVVMDSYGSELVEQ 237          
The following BLAST results are available for this feature:
BLAST of DN135033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
FCSA_DICDI5.476e-1635.29Fatty acyl-CoA synthetase A OS=Dictyostelium disco... [more]
ACSL1_CAVPO1.069e-1131.37Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porce... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca05c03 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone wca05c03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135033 ID=DN135033|Name=DN135033|organism=Citrus sinensis|type=EST|length=633bp
GGGGATAAATTGAAAGAATAAAAAAATTAGAAAGAGGAGTTTTTGTGCGA
TCNNNGATGAGTAACATGAAATATGTTGTTGAAGTGGAGAAGGCGAAGGA
GGCGAGCGGCGGAAGGCCTTCGATAGGTCCGGTGTATCGGAGTCTTTTTG
CTAAGGATGGATTTCCGGCTCCGATTCCGGGAATGGAGAGTTGTTGGGAC
GTTTTCCGCATGGCGGTGGAGAGAAATCCAAACAATCGGATGCTTGGTCA
ACGCGAGATTGTAGATGGAAAGGCTGGTAAATATGTGTGGAAAACTTATA
AAGAAGTATATGACTTGGTGATCAAAGTTGTAAATGCCATCCGCACTTGT
GGTGTTGAGGAAAGAGGAAAATGTGGTATTTACGGTGTCAATTGCCCAGA
GTGGATTATCGGCATGGAGGCTTGCAATGCTCTCGGCCTCCATTGTGTCC
CTCTGTACGACACTTTAGGTGCTGGTGCTGTGGAGTTTATTATATGCCAT
TCAGGGGTTTCAATTGCTTTTGTAGAGGAAAAAAAGATTCCTGAGATGCT
TAAAACATTTCCCAAGACCACAGAGCATTTAAAAACAATTGTGAGCTTTA
GCAAGGTTAAACCTGAGCAGAGGGAAGAGATTG
back to top