DN135026

Overview
NameDN135026
Unique NameDN135026
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length401
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2579 contig Csv1_Contig2579:411..810. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.209e-23
Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MSDTCGNCDCAD++QCVK+GSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.605e-19
Identity = 38/64 (59.38%), Postives = 48/64 (75.00%), Query Frame = 1
Query:   94 TCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 285
            TCGNCDC D+SQCVK+G+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.254e-18
Identity = 43/65 (66.15%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 279
            MSD CGNCDCAD SQCVK+G+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.416e-16
Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 279
            MS  C NCDC+D SQC K+G S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.416e-16
Identity = 38/66 (57.58%), Postives = 46/66 (69.70%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MS  C NCDCAD +QCVK+G+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.298e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MSD CGNCDCAD+SQCVK+G+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.298e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MSD CGNCDCAD+SQCVK+G+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.072e-13
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MSD CGNCDCAD+SQCVK+G+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DN135026 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.875e-13
Identity = 31/66 (46.97%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   85 MSDTCGNCDCADRSQCVKEGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 282
            MSD CG+CDCAD+SQCVK+G+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DN135026 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA2.209e-2368.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC9.605e-1959.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE1.254e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV3.416e-1656.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO3.416e-1657.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ1.298e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI1.298e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ2.072e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI7.875e-1346.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca05b03 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone wca05b03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135026 ID=DN135026|Name=DN135026|organism=Citrus sinensis|type=EST|length=401bp
GAGGACAGCAAAGCNNNNNAAGTTTCGTACAATAAAGAGCCCTCTATTTC
CAGTTTTAAGTTCTAAGTTCTAAGCTCAATCAACATGTCGGACACCTGCG
GCAACTGCGACTGCGCTGACAGGAGCCAGTGTGTGAAGGAGGGAAGCAGC
TATGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCACCGTTGT
TGTCATGGACGTTCAGGCTGCTGAGGCTGAAGGTAACTGCAAGTGCGGCC
CCACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTAATAAGCAAAC
ACATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTAAATATTGTGGGGG
TTAAGAATAATGTAAGGGTGATAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A
back to top