DT214573

Overview
NameDT214573
Unique NameDT214573
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length701
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP61_ARATH (Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.540e-88
Identity = 166/216 (76.85%), Postives = 179/216 (82.87%), Query Frame = -1
Query:   27 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATKGSFRR 674
            FAGTATAIVNQKT G+ETLIG A S GLAVM+VILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQ+MAS+ AAFALK +F P M GGVTVP+ G  +AFALEFIISFNLMF           VGELAGIAVGATVMLNILIAGP+T  SMNPVRTLGPA+A NNY+AIW+YLTAPILGAL GAGTY+ VKLPEED      P  + SFRR
Sbjct:   94 FAGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMASVSAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTIVKLPEED----EAPKERRSFRR 305          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP51_ARATH (Probable aquaporin NIP5-1 OS=Arabidopsis thaliana GN=NIP5-1 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 8.858e-77
Identity = 144/216 (66.67%), Postives = 166/216 (76.85%), Query Frame = -1
Query:   27 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATKGSFRR 674
            F  TA  IVNQK  G+ETLIG A   GLAVM++ILSTGHISGAHLNP++TIAFAAL+HFPW HVP YI AQ+ AS+CA+FALKG+FHP M GGVT+PS   G+AFALEFII+F L+F           VGELAGIAVGATVMLNIL+AGPSTGGSMNPVRTLGPAVA  NY+++W+YL AP LGA+ GA  Y+ VKL +  TD    P    SFRR
Sbjct:   92 FTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGVTIPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAISGAAVYTGVKLNDSVTD---PPRPVRSFRR 304          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP31_MAIZE (Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.205e-69
Identity = 137/218 (62.84%), Postives = 157/218 (72.02%), Query Frame = -1
Query:   27 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSA--GYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATKGSFRR 674
            F  TA  IVNQK  G+ +  G A   GLAV  VILSTGHISGAHLNP++TIAFAAL+HFPW  VP Y+  Q +AS+CAAFALKG+FHP + GGVTVP A     +AF  EFIISFNL+F           VGELAGIAVGA V LNIL+AGP+TGGSMNPVRTLGPAVA  NY+ +WIYL AP LGAL GA  Y AVKL +E+ +    P T+ SFRR
Sbjct:   88 FFATAAPIVNQKYGGAISPFGNAACAGLAVATVILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALASVCAAFALKGVFHPFLSGGVTVPDATVSTAQAFFTEFIISFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGASVYKAVKLRDENGET---PRTQRSFRR 302          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP31_ORYSJ (Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 1.282e-67
Identity = 132/218 (60.55%), Postives = 157/218 (72.02%), Query Frame = -1
Query:   27 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTV--PSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATKGSFRR 674
            F  TA  IVNQK  G+ +  G A   GLAV  +ILSTGHISGAHLNP++TIAFAAL+HFPW  VP Y+  Q++ S+CA FALKG+FHP + GGVTV  P+    +AF  EFII+FNL+F           VGELAGIAVGA V LNILIAGP+TGGSMNPVRTLGPAVA  NY+ +WIYL AP LGA+ GAG Y+AVKL +E+ +    P  + SFRR
Sbjct:   97 FFATAAPIVNQKYGGAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLGSICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVYTAVKLRDENGET---PRPQRSFRR 311          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP33_ORYSJ (Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.349e-51
Identity = 101/197 (51.27%), Postives = 135/197 (68.53%), Query Frame = -1
Query:   84 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKL 674
            F   +T I++++ +  ETL+G+A S GLAV V++LS  HISG HLNPA++IA A   H P  H+  YI +QI+ ++ A+FA+KG++HP+  G VTVP+ G  EAF +EFII+F L+F           V EL  +AVGATVM+NIL+AGPSTG SMNP RT+G A+A   Y  IW+YL A  LGA+ G G Y A+KL
Sbjct:   82 FTVLSTIIMDEQHKSIETLLGIATSAGLAVTVLVLSLIHISGCHLNPAISIAMAVFGHLPSAHLLPYISSQILGAVAASFAVKGLYHPVNPGIVTVPNVGTVEAFFVEFIITFFLLFIITALATDPNAVKELIAVAVGATVMMNILVAGPSTGASMNPARTIGAAIATGRYTQIWVYLVATPLGAIAGTGAYVAIKL 278          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP32_ORYSJ (Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.090e-50
Identity = 102/197 (51.78%), Postives = 133/197 (67.51%), Query Frame = -1
Query:   84 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKL 674
            F   +T I++++ +G E+L+G+A S GLAV V++LS  HISG HLNPAV+IA     H P  H+  YI AQI+ S+ A+FA+KG++HP+  G VTVP  G  EAF LEF+ +F L+F           V EL  +AVGAT+M+N L+AGPSTG SMNP RTLGPA+A   Y  IW+YL A  LGA+ G G Y A+KL
Sbjct:  109 FTVLSTIIMDEQHKGVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPPAHLLPYIAAQILGSITASFAVKGMYHPVNPGIVTVPKVGTVEAFFLEFVTTFVLLFIITALATDPNAVKELIAVAVGATIMMNALVAGPSTGASMNPARTLGPAIATGRYTQIWVYLVATPLGAVAGEGFYFAIKL 305          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP13_ORYSJ (Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 6.615e-48
Identity = 95/206 (46.12%), Postives = 131/206 (63.59%), Query Frame = -1
Query:   75 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGV------TVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEE 674
            FAG A   VN++T G+ T  G+  + GLAVMV++ S GHISGAHLNPAVT+AFA    FPW+ VP Y  AQ+  S  A+ AL+ +F     GG       T P+    ++ A+EFII+F LMF           +GELAG+AVGATV++N+L AGP +G SMNP RT+GPA+ +  Y  IW+Y+  P+ GA+ GA  Y+ ++  ++
Sbjct:   68 FAGCAAVAVNKRTGGTVTFPGICITWGLAVMVMVYSVGHISGAHLNPAVTLAFATCGRFPWRRVPAYAAAQVAGSAAASAALRALF-----GGAPEHFFGTAPAGSDVQSLAMEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLVNVLFAGPISGASMNPARTIGPAIILGRYTGIWVYIAGPVFGAVAGAWAYNLIRFTDK 268          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP12_ORYSJ (Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica GN=NIP1-2 PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 7.314e-47
Identity = 95/217 (43.78%), Postives = 129/217 (59.45%), Query Frame = -1
Query:   45 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGV-------TVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPAT 674
            FAG    +VNQ T G+ T  G+    GL VMV++ +  HISGAH NPAVT+AFA    F WK VP Y+ AQ++ S  A+  L+ +F    GG         T P+    +A ALEF+ISF LMF           +GELAG+AVGATV +N+L AGP TG SMNP R+LGPA+    Y  +W+Y+ AP+ G +CGA  Y+ ++  ++    +A  A+
Sbjct:   78 FAGCGAVVVNQSTGGAVTFPGICAVWGLVVMVLVYTVSHISGAHFNPAVTVAFATCGRFRWKQVPSYVVAQVLGSTMASLTLRVVFGGGGGGARGEHLFFGTTPAGSMAQAAALEFVISFFLMFVVSGVATDNRAIGELAGLAVGATVAVNVLFAGPVTGASMNPARSLGPAMVAGRYGGVWVYVAAPVSGTVCGAWAYNLLRFTDKPLRDIANTAS 294          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP23_MAIZE (Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.128e-46
Identity = 91/192 (47.40%), Postives = 123/192 (64.06%), Query Frame = -1
Query:   42 IGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATK 617
            +G + + GL V V+I +TGHISGAH+NPAVT++FA  +HFPW  VP Y  AQ   ++CAAF LK +  PI   G T PS  +  A A+E +++FN+MF           VGELAG+AVG+ V +  + AGP +GGSMNP RTL PAVA N +  +WIY   P++G L GA  Y+ ++   E+  A AKP T+
Sbjct:   88 LGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLQPIAVIGTTTPSGPHWHALAIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVVGTLSGAWVYTYIRF--EEAPAAAKPDTQ 277          
BLAST of DT214573 vs. ExPASy Swiss-Prot
Match: NIP11_ORYSJ (Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.087e-46
Identity = 96/217 (44.24%), Postives = 133/217 (61.29%), Query Frame = -1
Query:   33 FAGTATAIVNQKTQGSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMASLCAAFALKGIF---HPIMGGGVTVPSAGYGEAFALEFIISFNLMFXXXXXXXXXXXVGELAGIAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDTDALAKPATKGSF 674
            FAG     +NQ   G  T  G+A   GLAVMV++ + GHISGAH NPAVT+AFA  + FPW+ VP Y  AQ++ +  AA  L+ +F   H    G  T+P+    ++  LEFII+F LMF           +GELAG+AVGAT++LN+LIAGP +G SMNP R+LGPA+    Y++IW+Y+  P+ GA+ GA  Y+ ++   +    + K    GSF
Sbjct:   62 FAGCGAVTINQSKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATCRRFPWRQVPAYAAAQMLGATLAAGTLRLMFGGRHEHFPG--TLPAGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPISGASMNPARSLGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNIIRFTNKPLREITK---SGSF 273          
The following BLAST results are available for this feature:
BLAST of DT214573 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 189
Match NameE-valueIdentityDescription
NIP61_ARATH8.540e-8876.85Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1... [more]
NIP51_ARATH8.858e-7766.67Probable aquaporin NIP5-1 OS=Arabidopsis thaliana ... [more]
NIP31_MAIZE5.205e-6962.84Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1[more]
NIP31_ORYSJ1.282e-6760.55Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica G... [more]
NIP33_ORYSJ8.349e-5151.27Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica G... [more]
NIP32_ORYSJ1.090e-5051.78Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica G... [more]
NIP13_ORYSJ6.615e-4846.12Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica G... [more]
NIP12_ORYSJ7.314e-4743.78Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica G... [more]
NIP23_MAIZE2.128e-4647.40Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1[more]
NIP11_ORYSJ8.087e-4644.24Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_3G01_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-3G01-N1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214573 ID=DT214573|Name=DT214573|organism=Citrus sinensis|type=EST|length=701bp
ACTTCCGTGACAGTGTTGATCAATCACCTTCTGAAGCTGCCCTTTGTGGC
AGGCTTTGCGAGGGCATCGGTGTCTTCCTCCGGTAGCTTGACAGCAGAAT
AAGTTCCTGCACCGCATAATGCCCCAAGAATGGGGGCGGTCAGGTAGATC
CATATGGCCTTGTAATTGTTTACTGCTACGGCTGGCCCCAGTGTTCTTAC
TGGATTCATCGAGCCACCCGTTGATGGCCCGGCTATGAGTATGTTGAGCA
TGACAGTTGCTCCCACCGCGATTCCCGCCAACTCGCCCACAGCTCTCGTG
TCGGTGGCTACAGCAGTGACAACAAACATGAGATTGAAGCTAATTATGAA
TTCCAAAGCAAAAGCTTCACCATATCCTGCTGAAGGAACTGTGACTCCCC
CTCCCATAATTGGATGAAAAATTCCCTTTAAGGCAAATGCAGCACATAGT
GATGCCATTATTTGTGCTCCAATATAAACGGGTACATGTTTCCATGGAAA
GTGCTTTAGGGCAGCAAAGGCAATGGTGACAGCAGGGTTGAGATGGGCGC
CGGAGATGTGACCGGTCGATAAGATGACGACCATGACAGCGAGACCGGTG
GAGCCGGCGAGGCCAATTAGGGTTTCTGAGCCTTGTGTTTTCTGGTTCAC
AATAGCTGTGGCTGTCCCAGCAAAATATTAGCATAAGTGTGCCCACAAAT
T
back to top