DT214568

Overview
NameDT214568
Unique NameDT214568
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length835
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL18_ARATH (Probable pectate lyase 18 OS=Arabidopsis thaliana GN=At4g24780 PE=2 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 6.904e-101
Identity = 170/245 (69.39%), Postives = 203/245 (82.86%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            EL+MNS+KTIDGRG +V +S GPCI+I  V+NIIIH I+IHDC   G+A+VR SP+H+G R  SDGDG+SIFG   +W+DHC+FS+C DGLID + GSTAIT+SNN+M HH++VML+GHSD +S DKNMQVTIAFN FG+GLVQRMPRCRHG+FH+VNN YT WEMYAIGGSANPTINSQGN F+A N   +KEVTKHE   E  EWK+WNWRS GDL+LNGAFFTPSG    +SY KASS+ A+
Sbjct:  142 ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWRTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSDTYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPNIRFSKEVTKHEDAPE-SEWKRWNWRSSGDLLLNGAFFTPSGGAASSSYAKASSLGAK 385          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL22_ARATH (Probable pectate lyase 22 OS=Arabidopsis thaliana GN=At5g63180 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.538e-100
Identity = 171/247 (69.23%), Postives = 202/247 (81.78%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPS--GQETPASYMKASSMVAR 833
            EL+MNS+KT+DGRG +V +S GPCI+I  V+NIIIH ++IHDC   G+  VRDSP+HYG R  SDGDG+SIFG   +W+DHC+ S+C DGLID + GSTAITISNNY+ HHN+VML+GHSD +  DKNMQVTIAFN FG+GLVQRMPRCRHG+FH+VNN YT WEMYAIGGSANPTINSQGN F+A +D S+KEVTKHE   E DEW+ WNWRSEGDL+LNGAFFT S  G    +SY KASS+ AR
Sbjct:  164 ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGYRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPDDSSSKEVTKHEDAPE-DEWRNWNWRSEGDLLLNGAFFTYSGAGPAKSSSYSKASSLAAR 409          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL21_ARATH (Putative pectate lyase 21 OS=Arabidopsis thaliana GN=At5g55720 PE=2 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.302e-99
Identity = 174/245 (71.02%), Postives = 204/245 (83.27%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            +L + SYKTIDGRG NVQ++ GPC+++Y VSNIII+N+YIHDCVP    V R++    G  G SDGDGISIF SRDIWIDHCT   CYDGLID V GST ITISN+YM +HNEVML+GHSD++S D++M+VTIAFN+FG+GLVQRMPRCRHG+FHIVNNIY  W+MYAIGGSANPTI SQGNVFIASN++ TKEVTK E    D+EWK+WNW+SEGD M+NGAFFTPSG+E   SY K SSMVAR
Sbjct:  131 DLQVASYKTIDGRGNNVQIAYGPCLTLYKVSNIIINNLYIHDCVP----VKRNALSSLG--GYSDGDGISIFESRDIWIDHCTLEKCYDGLIDAVNGSTDITISNSYMLNHNEVMLLGHSDEYSGDRDMRVTIAFNYFGEGLVQRMPRCRHGYFHIVNNIYRDWKMYAIGGSANPTIFSQGNVFIASNNQFTKEVTKRESADGDEEWKEWNWKSEGDEMVNGAFFTPSGKEDSPSYAKFSSMVAR 369          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL5_ARATH (Probable pectate lyase 5 OS=Arabidopsis thaliana GN=At1g67750 PE=2 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 4.188e-98
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            EL+MNS+KTIDGRG +V ++ G CI++  V+NIIIH + IHDC   G+A VRDSP HYG R  SDGD +SIFG   +W+DHC+ S+C DGLID ++GSTAITISNNY+ HHN+VML+GHSD ++ DKNMQVTIAFN FG+GLVQRMPRCRHG+FH+VNN YT W+MYAIGGSA PTINSQGN F+A ND   KEVTK+E  +   +WKKWNWRSEGDL LNGAFFTPSG    +SY KASS+ AR
Sbjct:  142 ELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLSHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYE-DAPRSKWKKWNWRSEGDLFLNGAFFTPSGGGASSSYAKASSLSAR 385          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL_ZINEL (Pectate lyase OS=Zinnia elegans PE=1 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 2.715e-97
Identity = 168/245 (68.57%), Postives = 198/245 (80.82%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            ELVMNS+KTIDGRG NV + NGPCI+I+  SNIIIH I+IHDC  AG+  +R+SP H G   +SDGDGISIF S+DIWIDH + S+C+DGLID ++GSTAITISNNYM HH++VML+GHSD ++ DKNMQVTIAFN FG+GLVQRMPRCRHG+FH+VNN YT WEMYAIGGSA+PTI SQGN F+A N    KEVTKHE   E  EWK WNWRSEGDLMLNGA+F  SG    +S+ +ASS+  R
Sbjct:  135 ELVMNSHKTIDGRGVNVHIGNGPCITIHYASNIIIHGIHIHDCKQAGNGNIRNSPHHSGWWTQSDGDGISIFASKDIWIDHNSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQGNRFLAPNTRFDKEVTKHENAPE-SEWKNWNWRSEGDLMLNGAYFRESGGRAASSFARASSLSGR 378          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL18_SOLLC (Probable pectate lyase P18 OS=Solanum lycopersicum GN=9612 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.347e-96
Identity = 165/247 (66.80%), Postives = 201/247 (81.38%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFF--TPSGQETPASYMKASSMVAR 833
            ELVMNSYKTIDGRG +V +S GPCI+I++ SNIIIH I IHDC  +G+  +RDSP H G    SDGDGISIFG ++IW+DHC+ S+C+DGLID ++GSTAITISNNY  HH++VML+GHSD F+ DK MQVT+AFN FG+GLVQRMPRCRHG+FH+VNN YT WEMYAIGGSA PTINSQGN F+A N++  KEVTKHE   E  +W+ WNWRSEGDLMLNGA+F  T +G  + ++Y +ASS+ AR
Sbjct:  136 ELVMNSYKTIDGRGASVHISGGPCITIHHTSNIIIHGINIHDCKQSGNGNIRDSPNHSGWWDVSDGDGISIFGGKNIWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTHHDKVMLLGHSDSFTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNRFLAPNEKYRKEVTKHEDAPE-SQWRSWNWRSEGDLMLNGAYFRQTGAGASSSSTYARASSLSAR 381          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL15_ARATH (Probable pectate lyase 15 OS=Arabidopsis thaliana GN=At4g13710 PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 8.734e-96
Identity = 165/269 (61.34%), Postives = 200/269 (74.35%), Query Frame = -3
Query:   27 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVARXXXXXXXXXXXXXXXXSCRNSQPC 833
            EL+MNS+KTID RG NV ++NG CI+I  ++N+IIH ++IHDC P G+A+VR SP H+G R  +DGD +SIFGS  IWIDH + SHC DGL+D V GSTAIT+SNN+  HHNEVML+GHSD ++ DK MQVTIA+N FG+GLVQRMPRCRHG+FH+VNN YT WEMYAIGGSA PTINSQGN + A  D   KEVTK  + ++  EWKKWNWRSEGDL+LNGAFF PSG    ASY +ASS+ A+                 CR  +PC
Sbjct:  204 ELIMNSFKTIDARGSNVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAPMDRFAKEVTK-RVETDASEWKKWNWRSEGDLLLNGAFFRPSGAGASASYGRASSLAAK-PSSMVDTITSTAGALGCRKGRPC 470          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL10_ARATH (Probable pectate lyase 10 OS=Arabidopsis thaliana GN=At3g24670 PE=2 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 2.541e-95
Identity = 166/245 (67.76%), Postives = 195/245 (79.59%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            EL+MNS+KTIDGRG NV ++ G CI+I  V+NIIIH I +HDC   G+A+VR SP HYG R  +DGD ISIFGS  IWIDH + S+C DGLID + GSTAITISNNYM HHNEVMLMGHSD ++ DK MQVTIA+N FG+GL+QRMPRCRHG+FH+VNN YT W MYAIGGSANPTINSQGN F+A  +   KEVTK  + S   EWK+WNWRS+GDLMLNGA+FT SG   PASY +ASS+ A+
Sbjct:  174 ELIMNSFKTIDGRGVNVAIAGGACITIQYVTNIIIHGINVHDCRRTGNAMVRSSPSHYGWRTMADGDAISIFGSSHIWIDHNSLSNCADGLIDAIMGSTAITISNNYMTHHNEVMLMGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWVMYAIGGSANPTINSQGNRFLAPGNPFAKEVTK-RVGSWQGEWKQWNWRSQGDLMLNGAYFTKSGAAAPASYARASSLGAK 417          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL20_ARATH (Probable pectate lyase 20 OS=Arabidopsis thaliana GN=At5g48900 PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 7.393e-95
Identity = 164/245 (66.94%), Postives = 195/245 (79.59%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            EL+MNS+KTIDGRG NV ++NG CI+I  V+NIIIH I+IHDC P G+A+VR SP HYG R  +DGDGISIFGS  IWIDH + S+C DGLID V  STAITISNNY  HHNEVML+GHSD ++ DK MQVTIA+N FG+GL+QRMPRCRHG+FH+VNN YT WEMYAIGGSA+PTINSQGN ++A  +   KEVTK +   +  +W+ WNWRSEGDL LNGAFFT SG    ASY +ASS+ A+
Sbjct:  151 ELIMNSFKTIDGRGVNVHIANGACITIQFVTNIIIHGIHIHDCRPTGNAMVRSSPSHYGWRTMADGDGISIFGSSHIWIDHNSLSNCADGLIDAVMASTAITISNNYFTHHNEVMLLGHSDTYTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAPRNRFAKEVTKRDYAGQ-WQWRHWNWRSEGDLFLNGAFFTRSGSGLGASYARASSLAAK 394          
BLAST of DT214568 vs. ExPASy Swiss-Prot
Match: PEL8_ARATH (Probable pectate lyase 8 OS=Arabidopsis thaliana GN=At3g07010 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.669e-94
Identity = 160/245 (65.31%), Postives = 193/245 (78.78%), Query Frame = -3
Query:   99 ELVMNSYKTIDGRGFNVQMSNGPCISIYNVSNIIIHNIYIHDCVPAGSAVVRDSPKHYGPRGRSDGDGISIFGSRDIWIDHCTFSHCYDGLIDIVYGSTAITISNNYMFHHNEVMLMGHSDDFSADKNMQVTIAFNFFGDGLVQRMPRCRHGFFHIVNNIYTGWEMYAIGGSANPTINSQGNVFIASNDESTKEVTKHEIISEDDEWKKWNWRSEGDLMLNGAFFTPSGQETPASYMKASSMVAR 833
            EL+MNS+KTIDGRG NV ++NG C++I  V+NII+H I++HDC P G+A+VR SP HYG R  +DGD ISIFGS  IWIDH + S+C DGL+D V  STAIT+SNN+  HHNEVML+GHSD ++ DK MQVTIA+N FG+GL+QRMPRCRHG+FH+VNN YT WEMYAIGGSA PTINSQGN F+A  +   KEVTK E   E  +WK WNWRSEGDL LNGAFFT SG    A+Y +ASS+ A+
Sbjct:  150 ELIMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHVHDCKPTGNAMVRSSPSHYGFRSMADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDSYTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGNRFLAPVNPFAKEVTKREYTGE-SKWKHWNWRSEGDLFLNGAFFTRSGAGAGANYARASSLSAK 393          
The following BLAST results are available for this feature:
BLAST of DT214568 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
PEL18_ARATH6.904e-10169.39Probable pectate lyase 18 OS=Arabidopsis thaliana ... [more]
PEL22_ARATH1.538e-10069.23Probable pectate lyase 22 OS=Arabidopsis thaliana ... [more]
PEL21_ARATH1.302e-9971.02Putative pectate lyase 21 OS=Arabidopsis thaliana ... [more]
PEL5_ARATH4.188e-9867.76Probable pectate lyase 5 OS=Arabidopsis thaliana G... [more]
PEL_ZINEL2.715e-9768.57Pectate lyase OS=Zinnia elegans PE=1 SV=1[more]
PEL18_SOLLC1.347e-9666.80Probable pectate lyase P18 OS=Solanum lycopersicum... [more]
PEL15_ARATH8.734e-9661.34Probable pectate lyase 15 OS=Arabidopsis thaliana ... [more]
PEL10_ARATH2.541e-9567.76Probable pectate lyase 10 OS=Arabidopsis thaliana ... [more]
PEL20_ARATH7.393e-9566.94Probable pectate lyase 20 OS=Arabidopsis thaliana ... [more]
PEL8_ARATH3.669e-9465.31Probable pectate lyase 8 OS=Arabidopsis thaliana G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_23A09_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-23A09-A17-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214568 ID=DT214568|Name=DT214568|organism=Citrus sinensis|type=EST|length=835bp
GGTATAANCATTTGGTAGCAAAATTAGCAAGGTTGGCTATTCCGGCAACT
GAGCGTTCCGGCGGACGGAGAACTAGCAGTTAAAAGTGAAGTGGCCGGTC
TCGCAACCATGCTTGAAGCTTTCATGTAGCTTGCAGGAGTTTCTTGTCCA
GAAGGTGTAAAGAAAGCACCATTAAGCATCAGATCTCCTTCTGATCTCCA
ATTCCATTTCTTCCATTCATCATCTTCTGATATGATTTCATGTTTTGTCA
CCTCCTTGGTAGATTCGTCATTTGATGCTATGAAAACATTTCCTTGGCTA
TTGATTGTAGGATTAGCACTTCCTCCAATTGCATACATCTCCCACCCAGT
GTATATATTATTCACAATGTGAAAGAACCCATGTCGGCACCTGGGCATTC
TTTGAACAAGACCATCTCCGAAAAAATTGAAGGCAATGGTGACCTGCATA
TTCTTGTCAGCAGAGAAATCATCACTATGACCCATTAGCATGACTTCATT
GTGATGGAACATGTAGTTGTTTGAGATTGTTATGGCTGTAGAGCCATAAA
CAATGTCGATGAGTCCGTCATAGCAATGGGAGAAAGTACAGTGATCAATC
CAGATATCTCTTGAACCGAATATCGATATGCCATCTCCATCTGATCTGCC
TCTTGGTCCATAATGTTTCGGCGAGTCCCTCACCACAGCACTTCCTGCTG
GTACACAGTCATGTATGTAAATGTTATGTATGATGATGTTACTTACGTTG
TAAATTGATATGCATGGTCCATTTGACATTTGAACATTAAACCCTCTTCC
ATCTATGGTCTTGTATGAATTCATGACTAGTTCTT
back to top