DT214556

Overview
NameDT214556
Unique NameDT214556
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length747
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214556_ssr71 microsatellite DT214556_ssr71:71..82. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3773 contig Csv1_Contig3773:884..1629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214556 vs. ExPASy Swiss-Prot
Match: AFR_ARATH (F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 6.698e-47
Identity = 76/134 (56.72%), Postives = 99/134 (73.88%), Query Frame = -1
Query:  304 PLCFPPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNLDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVY 705
            P  FPP G VYD ++ TW  MS GMKEGWTG+S+V+  +LFVISEHGD PMK Y  DDDTWRYV G+K   E M RPFAV G + +++VV+SG+NVA GRV E QNG  S EW+++++P++    +P+SC V+Y
Sbjct:  238 PFMFPPMGQVYDSDEGTWREMSGGMKEGWTGVSVVIRDRLFVISEHGDFPMKVYCSDDDTWRYVSGEKLQGEKMRRPFAVTGADDRVFVVASGINVAEGRVSEGQNGDFSVEWRMVSSPKSSIQFSPASCHVLY 371          

HSP 2 Score: 38.5058 bits (88), Expect = 6.698e-47
Identity = 14/21 (66.67%), Postives = 16/21 (76.19%), Query Frame = -3
Query:  683 MGSKMYVTEGWTWPFMFSPKG 745
            +G +M VTEGW WPFMF P G
Sbjct:  225 IGKEMCVTEGWAWPFMFPPMG 245          
BLAST of DT214556 vs. ExPASy Swiss-Prot
Match: FBK17_ARATH (F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.587e-28
Identity = 52/135 (38.52%), Postives = 83/135 (61.48%), Query Frame = -1
Query:  301 PLCFPPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNLDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA 705
            P    PRG VYD   D W  MS G++EGWTG S+V+  +LF++SE     MK Y+   D+W  + G + P E + RPFAVN    ++YVV   L++A+G +++ +N   +  W+V+ +P  + D+ PS+ Q+++A
Sbjct:  266 PFFVSPRGQVYDPRTDQWETMSMGLREGWTGTSVVIYDRLFIVSELERMKMKVYDPVTDSWETINGPELP-EQICRPFAVNCYGNRVYVVGRNLHLAVGNIWQSEN-KFAVRWEVVESPERYADITPSNSQILFA 398          

HSP 2 Score: 35.4242 bits (80), Expect = 1.587e-28
Identity = 12/21 (57.14%), Postives = 15/21 (71.43%), Query Frame = -3
Query:  683 MGSKMYVTEGWTWPFMFSPKG 745
            +  K+ VTEGW WPF  SP+G
Sbjct:  253 LNGKLLVTEGWLWPFFVSPRG 273          
The following BLAST results are available for this feature:
BLAST of DT214556 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
AFR_ARATH6.698e-4756.72F-box protein AFR OS=Arabidopsis thaliana GN=AFR P... [more]
FBK17_ARATH1.587e-2838.52F-box/kelch-repeat protein At1g30090 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_14G09_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-14G09-M18-6.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214556 ID=DT214556|Name=DT214556|organism=Citrus sinensis|type=EST|length=747bp
AACCATGAATTTCATAACAAAGCCAGAAGGGATCACGAAATATCCCATAG
GGGGGATTGATTAAAACTCCCAAACAAACAAAATAGGAAGTAGGAACACA
CATTCTACCTACACAGCTGTGGCTGTCGCTTACAGATACGAAATCAAAAA
GCAGGCAAACACTTTATGAAGTAAGCAGCCTAATAGAAACAAAATCATGT
CAAGGTTAGGCCGAGATTAGCAGATAAACTACAACCTGGCCTTATGATGA
ATGATTGGCGCAGCATTATTGGCTCAAAGACAAACACTTCAATTAGTTTA
AGCGTAGACCACTTGGCAACTGGAGGGTGCTAAGTCCTTGAACGCCCTAG
GGGCAGTCATAACTTTCCACTCCGCTGAAATTCCCCCATTTTGTTCCTCA
TATACCCTTCCGATTGCCACGTTTAAACCACTTGACACCACATAAATTTT
CCCTTCCACTCCATTCACTGCAAACGGCCTATGCATAACTTCACATGGGA
ATTTGTCCCCACCCACATACCGCCACGTGTCGTCATCAAGGTTGTACTGC
TTCATTGGACAGTCACCGTGCTCTGATATCACGAACAGCTTGCCTTCAAG
CACGATACTGATCCCAGTCCATCCTTCCTTCATCCCATCGCTCATCAAAT
TCCACGTGTCCTTGTTGATGTCGTAGACCCCACCCCTTGGGGGAAAACAT
AAAGGGCCACGTCCATCCCTCAGTCACATACATCTTGCTCCCCATCA
back to top