DT214554

Overview
NameDT214554
Unique NameDT214554
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length842
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214554_ssr324 microsatellite DT214554_ssr324:324..335. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6528 contig Csv1_Contig6528:1..842. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR1_ARATH (Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.390e-16
Identity = 38/42 (90.48%), Postives = 41/42 (97.62%), Query Frame = -1
Query:  714 LKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 839
            LKYVG+ELWQVKSG++FDNVLVSDDPEYA KLAEETWGKHKD
Sbjct:  315 LKYVGVELWQVKSGSLFDNVLVSDDPEYAKKLAEETWGKHKD 356          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_BERST (Calreticulin OS=Berberis stolonifera PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.177e-15
Identity = 37/42 (88.10%), Postives = 40/42 (95.24%), Query Frame = -1
Query:  714 LKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 839
            LKYVGIELWQVKSGTMFDNVL+ DDP+YA KLAEETWGK+KD
Sbjct:  315 LKYVGIELWQVKSGTMFDNVLICDDPDYAKKLAEETWGKNKD 356          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_PRUAR (Calreticulin OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.007e-15
Identity = 35/43 (81.40%), Postives = 41/43 (95.35%), Query Frame = -1
Query:  714 NLKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 842
            NLKYVGIELWQVKSGT+FDN+L++D+PEYA +LAEETWGK KD
Sbjct:  316 NLKYVGIELWQVKSGTLFDNILITDEPEYAKQLAEETWGKQKD 358          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_RICCO (Calreticulin OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.622e-15
Identity = 36/43 (83.72%), Postives = 41/43 (95.35%), Query Frame = -1
Query:  714 NLKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 842
            NLKYVGIELWQVKSGT+FDNVL+ +DPEYA +LAEETWGK+KD
Sbjct:  312 NLKYVGIELWQVKSGTLFDNVLICNDPEYAKQLAEETWGKNKD 354          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_BETVU (Calreticulin OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 9.962e-15
Identity = 35/42 (83.33%), Postives = 39/42 (92.86%), Query Frame = -1
Query:  714 LKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 839
            L+YVG+ELWQVKSGT+FDNVLV DDPEYA +LAEETWGK KD
Sbjct:  318 LRYVGVELWQVKSGTLFDNVLVCDDPEYAKQLAEETWGKQKD 359          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_ORYSJ (Calreticulin OS=Oryza sativa subsp. japonica GN=Os07g0246200 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 4.944e-14
Identity = 33/43 (76.74%), Postives = 38/43 (88.37%), Query Frame = -1
Query:  714 NLKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 842
            +LKY+GIELWQVKSGT+FDN L++DDPE A   AEETWGKHKD
Sbjct:  321 SLKYIGIELWQVKSGTLFDNFLITDDPELAKTFAEETWGKHKD 363          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_NICPL (Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.944e-14
Identity = 32/42 (76.19%), Postives = 38/42 (90.48%), Query Frame = -1
Query:  714 LKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 839
            LKYVG+ELWQVKSGT+FDN+++ DDPEYA  +AEETWGK KD
Sbjct:  320 LKYVGVELWQVKSGTLFDNIVICDDPEYAKAIAEETWGKQKD 361          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR2_ARATH (Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 8.434e-14
Identity = 33/42 (78.57%), Postives = 39/42 (92.86%), Query Frame = -1
Query:  714 LKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 839
            LKYVG+ELWQVKSG++FDNVL+ DDP+YA KLA+ETWGK KD
Sbjct:  315 LKYVGLELWQVKSGSLFDNVLICDDPDYAKKLADETWGKLKD 356          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_MAIZE (Calreticulin OS=Zea mays GN=CRT PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.186e-13
Identity = 30/43 (69.77%), Postives = 38/43 (88.37%), Query Frame = -1
Query:  714 NLKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 842
            +LKY+GIELWQVKSGT+FDN++++DDP  A   AEETWGKHK+
Sbjct:  317 SLKYIGIELWQVKSGTLFDNIIITDDPALAKTFAEETWGKHKE 359          
BLAST of DT214554 vs. ExPASy Swiss-Prot
Match: CALR_CHLRE (Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.713e-12
Identity = 31/43 (72.09%), Postives = 38/43 (88.37%), Query Frame = -1
Query:  714 NLKYVGIELWQVKSGTMFDNVLVSDDPEYANKLAEETWGKHKD 842
            +LK+VG ELWQVKSG++FDN+LV+DD E A K AE+TWGKHKD
Sbjct:  314 DLKFVGFELWQVKSGSIFDNILVTDDLEAAKKFAEDTWGKHKD 356          
The following BLAST results are available for this feature:
BLAST of DT214554 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
CALR1_ARATH1.390e-1690.48Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=... [more]
CALR_BERST1.177e-1588.10Calreticulin OS=Berberis stolonifera PE=2 SV=1[more]
CALR_PRUAR2.007e-1581.40Calreticulin OS=Prunus armeniaca PE=2 SV=1[more]
CALR_RICCO2.622e-1583.72Calreticulin OS=Ricinus communis PE=2 SV=1[more]
CALR_BETVU9.962e-1583.33Calreticulin OS=Beta vulgaris PE=2 SV=1[more]
CALR_ORYSJ4.944e-1476.74Calreticulin OS=Oryza sativa subsp. japonica GN=Os... [more]
CALR_NICPL4.944e-1476.19Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 ... [more]
CALR2_ARATH8.434e-1478.57Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=... [more]
CALR_MAIZE4.186e-1369.77Calreticulin OS=Zea mays GN=CRT PE=2 SV=1[more]
CALR_CHLRE2.713e-1272.09Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12F03_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-12F03-L6-6.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214554 ID=DT214554|Name=DT214554|organism=Citrus sinensis|type=EST|length=842bp
TCAAAGTATATTCATAAATGTGTCCATAAAAAGCCCACAATATTTCAATC
CTCTTTGTTCTAAAAGCTCAGATAGTTAAAATGAGATTTAAGCAATGATC
GGCCACACAAATTTTAAACGCAGCCTTTCTTTCTACTCTTCAGGTCACTT
TCCTAAAGCATAAACGTCCCTAGAGCTGAAAATCAAAATAGAAAACAGAA
AAATTTTGGAGCATCTTTACGCCCAAATTCTCGGGGCTTATCATAGCATT
TTCCCCTACAGCTCATCATGTACATCCTTGTCTGCGTCTCCGCTGCTGGA
GTCTGATTTGGTTTCAGTATCAGCATCATCATCATCTTCAGTGTCATCGT
CATCATTATCCTCAGCATCAGAATCAGGTGCGTCCTTTGATTCCTGTTAA
CCACATTTCAGAAAGTTAGCATAACTGGTAACACAGAATAGAATCAAAAA
AGTTTTCAACAGATAAGTTTTCATCTAGGTAAATGATTATGTCTTTGGAA
ACTCAGCTAAGTATGCTAAAAACCCAATTCCAAAGAAAAAATAAAATGTG
CAACAAAGTAATTGAGCAAAAAAGCACCTCCTCCTCTCTCTTCTTCTCGG
CCTCATCAAATGCTGCCTTCTCGGCCTGCAAAAACAATAGGTCTCCAAAT
CAAATACTGAGGCTTGTAAGTATCAGTTATGAGACAGATTTGATGAGGAG
AAAACAATCATACATCCTTATGCTTTCCCCATGTTTCTTCGGCCAACTTA
TTGGCATACTCTGGATCATCACTAACCAAGACATTGTCAAACATGGTTCC
AGATTTCACCTGCCACAACTCAATGCCAACATACTTCAAGTT
back to top