DT214527

Overview
NameDT214527
Unique NameDT214527
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214527 vs. ExPASy Swiss-Prot
Match: CPRF1_PETCR (Common plant regulatory factor 1 OS=Petroselinum crispum GN=CPRF1 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.357e-27
Identity = 68/122 (55.74%), Postives = 92/122 (75.41%), Query Frame = -2
Query:  283 QAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVL--NEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG 642
            QAEAEEL+ KVDSL  EN +LK+EIN+L+  +EKL  +N+ LLE +K+AQ     ++ L  N +K+ + +ST NLLSRV+N+G+ DR+ E    ++EK + SGAKLHQLLDA+PRTDAVAAG
Sbjct:  291 QAEAEELAIKVDSLTAENMALKAEINRLTLTAEKLTNDNSRLLEVMKNAQAERAADVGLGNNNEKKASTLSTANLLSRVDNAGSGDRD-EGESDVYEKTTKSGAKLHQLLDANPRTDAVAAG 411          
BLAST of DT214527 vs. ExPASy Swiss-Prot
Match: GBF3_ARATH (G-box-binding factor 3 OS=Arabidopsis thaliana GN=GBF3 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.108e-21
Identity = 61/120 (50.83%), Postives = 79/120 (65.83%), Query Frame = -2
Query:  283 QAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG 642
            QAE EEL+RKV++L  EN +L+SE+NQL+E S+KLR  NA LL+KLK ++           +KRV      N+LSRV NSG  D+N  +G    + +SNS +KLHQLLD  PR  AVAAG
Sbjct:  281 QAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANATLLDKLKCSE----------PEKRV----PANMLSRVKNSGAGDKNKNQG----DNDSNSTSKLHQLLDTKPRAKAVAAG 382          
BLAST of DT214527 vs. ExPASy Swiss-Prot
Match: GBF2_ARATH (G-box-binding factor 2 OS=Arabidopsis thaliana GN=GBF2 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.261e-14
Identity = 55/121 (45.45%), Postives = 70/121 (57.85%), Query Frame = -2
Query:  286 QAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKL--HQLLDASPRTDAVAA 642
            QAE E+LS KVD+L+ EN SL+S++ QL+  SEKLR EN A+L++LK+   G                 TENL+SR      VD+N          NS SG+K   HQLL+ASP TD VAA
Sbjct:  271 QAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEAILDQLKAQATG----------------KTENLISR------VDKN----------NSVSGSKTVQHQLLNASPITDPVAA 359          
The following BLAST results are available for this feature:
BLAST of DT214527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CPRF1_PETCR3.357e-2755.74Common plant regulatory factor 1 OS=Petroselinum c... [more]
GBF3_ARATH2.108e-2150.83G-box-binding factor 3 OS=Arabidopsis thaliana GN=... [more]
GBF2_ARATH7.261e-1445.45G-box-binding factor 2 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_5B10_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-5B10-C19-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214527 ID=DT214527|Name=DT214527|organism=Citrus sinensis|type=EST|length=763bp
CCTAATAATACGACATAACATAGATTCCAAAGTCCTTTCCCCCCTAAACT
GAACCCCTTTAGGGGTCCTCCTTAAATGTACACCCATCTCCCATCCTATC
ACTCTGATTTTTACTAAAATACATCAGGTTTGCCATGAGTTAAAAAGACA
ACCAACCACATTACACACGACATAGAACAACACTAATTCAGCTATTTAAT
TCATTCTTTCTGGCTGTTAGCTCTAGTTTCCGAGGCAGACAAGCAAAACG
GCTTCTACAGAAAGAGTTAAAAGAGTTAATCAGCCTGCAGCCACGGCATC
TGTCCTTGGACTTGCATCCAAAAGCTGATGTAGCTTGGCACCAGAGTTTG
AGTTTTTCTCAAACAGGTGACCTCCTTCCTCCATGTTTCTATCAACAGTA
CCGGAGTTGTTAACTCTAGATAATAGGTTTTCTGTGCTAACAGGTGTAAC
CCTCTTGTCCTCGTTCAAAACAATCTCTTGCTTGTTTCCCAGTTGTGCAC
TCTTCAGTTTTTCCAGTAATGCTGCGTTTTCTTGCCTCAGTTTCTCAGAA
TTCTCTGATAATTGATTTATTTCAGACTTGAGGGAAGCATTCTCATCAAT
CAAGGAATCAACTTTACGAGAAAGTTCTTCAGCCTCAGCCTGGAAGGAAG
TTTTAAATAGGGAGAAGCAAGAAAATTAGCTCCTATATTGATGAGAGCTA
TACAGTGATTCCAACAATTGAAACAAAGTTTTTAAGTAAGAGTACTCTCA
CATCTCTTTTTAC
back to top