DT214522

Overview
NameDT214522
Unique NameDT214522
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length857
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2540_HUMAN (Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.280e-12
Identity = 39/108 (36.11%), Postives = 58/108 (53.70%), Query Frame = -3
Query:  193 CTCAVPGSEP-APECNRYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 513
            C C   G++    +   ++GTLD F+K++R EG   LW G   +L ++VP   IY +CYD    L+ +    N       +P+VAG VAR  A     P++L RT+MQ
Sbjct:   67 CVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLSALLRSKLGENETC----IPIVAGIVARFGAVTVISPLELIRTKMQ 170          

HSP 2 Score: 23.0978 bits (48), Expect = 1.280e-12
Identity = 10/22 (45.45%), Postives = 16/22 (72.73%), Query Frame = -2
Query:  521 IVSAVIVNPLDVAKMLPDMRNS 586
            I+++VIV PLDV K+    +N+
Sbjct:   27 ILTSVIVTPLDVVKIRLQAQNN 48          
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2540_BOVIN (Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.367e-11
Identity = 39/108 (36.11%), Postives = 57/108 (52.78%), Query Frame = -3
Query:  193 CTCAVPGSEP-APECNRYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 513
            C C   G++    +   ++GTLD F K++R EG   LW G   +L ++VP   IY +CYD    L+ +    N       +P+VAG VAR  A     P++L RT+MQ
Sbjct:   67 CVCEEEGNKAWYKKPGHFQGTLDAFLKIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLTALLRSKLGEN----ESRIPIVAGIVARLGAVTVISPLELIRTKMQ 170          
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2539_RAT (Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.367e-11
Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = -3
Query:  193 RYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 468
            R+ GTLD F K+VR EG   LW G  A+L ++VP   IY + YD     ++ F  G +     Y P+VAG++AR        P++L RT++Q
Sbjct:  103 RFTGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQ----LKAFLCGQSLTSDLYAPMVAGALARMGTVTVVSPLELVRTKLQ 190          
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2539_MOUSE (Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.367e-11
Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = -3
Query:  193 RYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 468
            R+ GTLD F K+VR EG   LW G  A+L ++VP   IY + YD     ++ F  G +     Y P+VAG++AR        P++L RT++Q
Sbjct:  103 RFTGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQ----LKAFLCGQSLTSDLYAPMVAGALARMGTVTVVSPLELVRTKLQ 190          
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2539_HUMAN (Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.091e-11
Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = -3
Query:  193 RYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 468
            R+ GT+D F K+VR EG   LW G  A+L ++VP   IY + YD     ++ F  G A     Y P+VAG++AR        P++L RT++Q
Sbjct:  103 RFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQ----LKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQ 190          
BLAST of DT214522 vs. ExPASy Swiss-Prot
Match: S2539_BOVIN (Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 8.994e-11
Identity = 35/92 (38.04%), Postives = 51/92 (55.43%), Query Frame = -3
Query:  193 RYKGTLDVFYKVVRQEGFTRLWRGTYASLALSVPTVGIYLSCYDSFRNLMENFTTGNAPLLTPYVPLVAGSVARSLACISCYPIKLARTQMQ 468
            R+ GT+D F K+VR EG   LW G  A+L ++VP    Y + YD     ++ F  G A     Y P+VAG++AR        P++L RT++Q
Sbjct:  103 RFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAAYFTAYDQ----LKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELVRTKLQ 190          
The following BLAST results are available for this feature:
BLAST of DT214522 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
S2540_HUMAN1.280e-1236.11Solute carrier family 25 member 40 OS=Homo sapiens... [more]
S2540_BOVIN2.367e-1136.11Solute carrier family 25 member 40 OS=Bos taurus G... [more]
S2539_RAT2.367e-1139.13Solute carrier family 25 member 39 OS=Rattus norve... [more]
S2539_MOUSE2.367e-1139.13Solute carrier family 25 member 39 OS=Mus musculus... [more]
S2539_HUMAN3.091e-1139.13Solute carrier family 25 member 39 OS=Homo sapiens... [more]
S2539_BOVIN8.994e-1138.04Solute carrier family 25 member 39 OS=Bos taurus G... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_52G09_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-52G09-N18-1-4.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214522 ID=DT214522|Name=DT214522|organism=Citrus sinensis|type=EST|length=857bp
TAATCTAAAAAATTTATTACATTGTTTAGAACTACAACACTAAAACCTTT
AAGCCAAATAACTATATTAAACTCATAAAAAGCTTATAATTTATAGGAGA
AACTGAAAGTATCAATCAATTTTGAGGCAACCAATTTGACAATTTAATAT
TAAACTCATTAAAAGCATTGCCAATAGTGAGTTTAAATATACCTGCATCT
GTGTCCTTGCCAATTTGATGGGGTAGCAACTAATACATGCTAATGAACGT
GCAACAGACCCAGCAACTAAGGGGACATATGGTGTCAACAGTGGAGCATT
GCCAGTAGTGAAATTTTCCATCAAATTGCGAAAACTGTCATAACAAGAAA
GGTAAATTCCCACTGTTGGCACAGACAATGCTAAACTTGCATAAGTGCCT
CTCCATAGTCGGGTAAATCCCTCCTGGCGTACGACTTTGTAGAAAACATC
CAGTGTTCCTTTATATCTATTACATTCTGGAGCTGGTTCAGAGCCTGGAA
CTGCACACGTGCATGATCAGAGAATTTCTCATATCTGGAAGCATCTTAGC
GACATCGAGAGGATTAACAATAACGGCAGAAACGATAGTAGTGCCGGCAG
TAGAGAAAGCCCTTTCTGCAAACCCCAAACTGAAATCTTTTATGGCTTCT
GAATGCCGTAAAGCTTCCTCTTTAGACGAAGTCTCAGATGATACTGAGAC
GGACGAAACGCTTCCCTCCAAATCAACCCTGGTCGCCGCCAACATGCAAA
TGAGAAATTGGACATGAGGAGTGGCTAAGAGGCCGCTGTTGAAGAAGTGC
TTCTTGCACCAGTGCTTTTTGCTACTGTTGATGCTGCTTCAACCTCTGGT
ACTGCAT
back to top