DT214517

Overview
NameDT214517
Unique NameDT214517
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length828
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4673 contig Csv1_Contig4673:2..829. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: TRAD1_HUMAN (TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens GN=TRAFD1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.796e-15
Identity = 31/97 (31.96%), Postives = 50/97 (51.55%), Query Frame = -2
Query:  537 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 827
            ++C +C + IP  N  +H  HC RN+  C  C +  P+   E H    H  V C +C++ +E+ +L  H+   CP R+  C  C+  L  + L EH+
Sbjct:   11 RLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTC-KCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHE 106          

HSP 2 Score: 23.483 bits (49), Expect = 6.796e-15
Identity = 24/120 (20.00%), Postives = 42/120 (35.00%), Query Frame = -1
Query:  148 TELCHLCNRYIRLRERYNHESRC----------TGVPENTVGSS-------------RNVRAAESDQGAHRRPAPPPPNEFYRKRFLLTIAITGIAVLLGSLFFQRKTETSQVH*QQNRG 438
            TELC  C R + +++   H   C            +P N    S             R + A +      RRP     ++ +  R      IT    +  +LF +++ +      ++NRG
Sbjct:  113 TELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQ------ERNRG 226          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: TRAD1_RAT (TRAF-type zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Trafd1 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 6.798e-15
Identity = 32/97 (32.99%), Postives = 49/97 (50.52%), Query Frame = -2
Query:  537 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 827
            ++C +C + IP  N  +H  HC RN+  C VC +  P+   + H    H  V C +C++ +E+  L  H    CP R+  C  C+  L  V L EH+
Sbjct:   11 RLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHVATEHCQVTC-KCNKKLEKRQLKQHVETECPLRLAVCQHCDLELSVVKLKEHE 106          

HSP 2 Score: 25.7942 bits (55), Expect = 6.798e-15
Identity = 11/28 (39.29%), Postives = 15/28 (53.57%), Query Frame = -1
Query:  355 TELCHLCNRYIRLRERYNHESRCTGVPE 438
            TELC  C R + ++E   H + C  V E
Sbjct:  113 TELCGSCGRNVLVKELQTHPAVCGRVEE 140          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: TRAD1_MACFA (TRAF-type zinc finger domain-containing protein 1 OS=Macaca fascicularis GN=TRAFD1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.830e-15
Identity = 31/97 (31.96%), Postives = 51/97 (52.58%), Query Frame = -2
Query:  537 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 827
            ++C +C + IP  N  +H  HC RN+  C +C +  P+   E H    H  V C +C++ +E+ +L  H+   CP R+  C  C+  L  + L EH+
Sbjct:   11 RLCDNCKKEIPVFNFTIHEIHCQRNIGMCPICKEPFPKSDMETHMAAEHCQVTC-KCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHE 106          

HSP 2 Score: 21.9422 bits (45), Expect = 8.830e-15
Identity = 8/23 (34.78%), Postives = 12/23 (52.17%), Query Frame = -1
Query:  370 TELCHLCNRYIRLRERYNHESRC 438
            TELC  C R + +++   H   C
Sbjct:  113 TELCGNCGRNVLVKDLKTHPEVC 135          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: TRAD1_MOUSE (TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus GN=Trafd1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.147e-14
Identity = 32/97 (32.99%), Postives = 49/97 (50.52%), Query Frame = -2
Query:  537 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 827
            ++C +C + IP  N  +H  HC RN+  C VC +  P+   + H    H  V C +C++ +E+  L  H    CP R+  C  C+  L  V L EH+
Sbjct:   11 RLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHMAAEHCQVTC-KCNKKLEKRQLKQHAETECPLRLAVCQHCDLELSVVKLKEHE 106          

HSP 2 Score: 25.0238 bits (53), Expect = 1.147e-14
Identity = 11/28 (39.29%), Postives = 14/28 (50.00%), Query Frame = -1
Query:  355 TELCHLCNRYIRLRERYNHESRCTGVPE 438
            TELC  C R + ++E   H   C  V E
Sbjct:  113 TELCGSCGRNVLVKELKTHPEVCGRVEE 140          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: TRAD1_BOVIN (TRAF-type zinc finger domain-containing protein 1 OS=Bos taurus GN=TRAFD1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.269e-14
Identity = 31/97 (31.96%), Postives = 50/97 (51.55%), Query Frame = -2
Query:  537 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 827
            ++C +C + IP  N  +H  HC RN+  C VC +  P+   E H    H  V C +C++ +E+  L  H+   CP R+  C  C+  L  + L +H+
Sbjct:   11 RLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKCDMETHMATEHCQVTC-KCNKKLEKRQLKKHEETECPLRLALCQHCDLELSVLKLKDHE 106          

HSP 2 Score: 23.8682 bits (50), Expect = 3.269e-14
Identity = 14/49 (28.57%), Postives = 21/49 (42.86%), Query Frame = -1
Query:  295 TELCHLCNRYIRLRERYNHESRC-TGVPENTVGSSRNVRAAESDQGAHR 438
            TELC  C R + +++   H   C   V E  V ++    A +   G  R
Sbjct:  113 TELCGTCGRNVLVKDLKTHPEVCGRDVEEKRVEAAMPPNAYDESWGPDR 161          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: XAF1_BOVIN (XIAP-associated factor 1 OS=Bos taurus GN=XAF1 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 4.326e-14
Identity = 34/98 (34.69%), Postives = 52/98 (53.06%), Query Frame = -2
Query:  540 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFP--LPAVDLAEH 827
            ++C +C R + S+++ LH AHC   L  C  C + V +   EEH    H  V C+ C +++ +  L  H+ + C +R V C FC+    L  VDL EH
Sbjct:    6 QVCRNCKRRVASNHLGLHEAHCLMYLVLCPECKEPVLQHEMEEHCQGGHQQVGCAMCQQSVPKHSLDSHEAQECQERPVECQFCQLAVRLNKVDLHEH 103          

HSP 2 Score: 25.409 bits (54), Expect = 4.326e-14
Identity = 12/34 (35.29%), Postives = 18/34 (52.94%), Query Frame = -1
Query:  361 KSVGITE---LCHLCNRYIRLRERYNHESRCTGV 453
            KS+ + E    CH CN+ I   + ++H  RC  V
Sbjct:  142 KSIPVPESNICCHYCNQMIPGNKYFHHLDRCRRV 175          
BLAST of DT214517 vs. ExPASy Swiss-Prot
Match: XAF1_HUMAN (XIAP-associated factor 1 OS=Homo sapiens GN=XAF1 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.844e-14
Identity = 34/96 (35.42%), Postives = 51/96 (53.12%), Query Frame = -2
Query:  537 ICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGENCPQRIVTCDFCEFPLPAVDLAEHQ 824
            +C +C R + S+N  LH A+C R L  C  C + VP++  EEH    H  V C+ C ++M++  L  HK   C +R V C FC+  +    L  H+
Sbjct:    7 VCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHE 102          
The following BLAST results are available for this feature:
BLAST of DT214517 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
TRAD1_HUMAN6.796e-1531.96TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_RAT6.798e-1532.99TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_MACFA8.830e-1531.96TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_MOUSE1.147e-1432.99TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_BOVIN3.269e-1431.96TRAF-type zinc finger domain-containing protein 1 ... [more]
XAF1_BOVIN4.326e-1434.69XIAP-associated factor 1 OS=Bos taurus GN=XAF1 PE=... [more]
XAF1_HUMAN4.844e-1435.42XIAP-associated factor 1 OS=Homo sapiens GN=XAF1 P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_40H10_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-40H10-P20-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214517 ID=DT214517|Name=DT214517|organism=Citrus sinensis|type=EST|length=828bp
GAAACAATGTTGCATAGCCGTTCAACATATTGCCAAAATGCCAATGAGTT
CAGTGAGGTCATAGCAGTACATGCTTTTAGATGATCTAGGTACAGATAAA
TGGAATACATTGGTTTGTCACCGACATATATACTCCTCCCGTGTTTATCC
TCTATTCTGCTGCTAATGCACTTGACTAGTCTCTGTCTTTCTCTGGAAAA
AAAGAGATCCTAATAGAACAGCAATGCCTGTTATTGCTATGGTAAGTAGA
AATCGTTTCCGATAAAACTCGTTTGGCGGCGGGGGTGCCGGCCTTCTGTG
AGCCCCTTGGTCACTTTCAGCTGCCCTTACATTCCTGGAAGATCCAACAG
TGTTTTCTGGGACACCTGTGCACCTACTTTCATGGTTATATCTTTCTCGC
AACCTAATATATCTGTTACACAGATGACAAAGTTCTGTGATTCCCACAGA
CTTCCTACAATAACAAAGCAACAAAGCATCACACCCAAGTAGGAAGATAT
TGTCTTTCCATTTTCAAAATTATTGACGATTGCCACCTGATGCTCGGCCA
GATCAACTGCAGGCAGTGGAAACTCACAAAAGTCGCAAGTGACAATCCTT
TGCGGGCAATTTTCACCTTTATGGATGGCTAAAATTTCACGCTCCATTGT
CTCGCTGCACTGTGAACAGGCCACCGGGGCATGGGTATTTAAGAAGTGCT
CCTCAGCATATTTCCTTGGAACCATGTCACCACATACTTTACATCGTTCC
AGATTCCGCGAGCAATGTGCAAAATGCAAATCAATATTTGAAGACGGTAT
AGCTCTGTCACAGTGACTGCATATTTTT
back to top