DT214516

Overview
NameDT214516
Unique NameDT214516
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length780
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2447 contig Csv1_Contig2447:46..825. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: ZOG_PHALU (Zeatin O-glucosyltransferase OS=Phaseolus lunatus GN=ZOG1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.813e-29
Identity = 70/170 (41.18%), Postives = 107/170 (62.94%), Query Frame = -3
Query:  269 KLMALVIGLEASAKSFIWVIRPPIGFDL--RGEFRSEWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVE--EMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDG 766
            ++  +  GLE S + FIWV+R     D+    E +   LP+GFEER++ +  GL+VR+WAPQLEILSH STG F+SHCGWNS +ES++ GVP+  WPM ++Q  N+ ++ E  ++G+ V+      S +    VEN +  +M+   +G EM+++A ++   I  SM E G
Sbjct:  278 QIQQIATGLEQSKQKFIWVLREADKGDIFAGSEAKRYELPKGFEERVEGM--GLVVRDWAPQLEILSHSSTGGFMSHCGWNSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGVRRLME-TKEGDEMRQRAVRLKNAIHRSMDEGG 444          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: ZOX_PHAVU (Zeatin O-xylosyltransferase OS=Phaseolus vulgaris GN=ZOX1 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.674e-29
Identity = 70/173 (40.46%), Postives = 110/173 (63.58%), Query Frame = -3
Query:  260 KLMALVIGLEASAKSFIWVIRPPIGFDL--RGEFRSEWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVE--EMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDGEDR 766
            ++  L  GLE S + FIWV+R     D+    E +   LPEGFEER++ +  GL+VR+WAPQ+EILSH STG F+SHCGWNS +ESL++GVP+  W M ++Q  N+ ++ +  ++G+ V+     +S +    +EN +  +M+   +G E++++A K+  +I  SM E G  R
Sbjct:  273 QIQELATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPEGFEERVEGM--GLVVRDWAPQMEILSHSSTGGFMSHCGWNSCLESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAVRRLME-TKEGDEIRKRAVKLKDEIHRSMDEGGVSR 442          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: ANGLT_ROSHC (Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hybrid cultivar GN=RhGT1 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.674e-29
Identity = 72/178 (40.45%), Postives = 107/178 (60.11%), Query Frame = -3
Query:  239 KLMALVIGLEASAKSFIWVIRPPIGFDLRGEFRS--EWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVEEMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDGEDRGSSLKGL 766
            +L A+ +GLE S + F+WV+R P   +L  E  S  E LP+GF ER K+  +GL+VR WAPQ+E+LSH S G F++HCGWNSV+E++  GVP++ WP+ AEQ      LVEEM VAV +       +   E+E  +  +MD +  G E++ +      +     ++  E+ GSS+  L
Sbjct:  293 QLEAMALGLEKSGQRFLWVVRNPPIEELPVEEPSLEEILPKGFVERTKD--RGLVVRKWAPQVEVLSHDSVGGFVTHCGWNSVLEAVCNGVPMVAWPLYAEQKLGRVFLVEEMKVAVGVKESETGFVSADELEKRVRELMD-SESGDEIRGRVS----EFSNGGVKAKEEGGSSVASL 463          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: UFOG4_MANES (Anthocyanidin 3-O-glucosyltransferase 4 (Fragment) OS=Manihot esculenta GN=GT4 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.266e-29
Identity = 69/179 (38.55%), Postives = 108/179 (60.34%), Query Frame = -3
Query:  269 KLMALVIGLEASAKSFIWVIRPPIGFDLRGEFRSEW-LPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVEEMGVAVELTRGVQSTIV------------GHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDG 766
            +L  L +GLE++ + FIWVIR       + E   +W L EG+EER K  ++   +R W+PQ+ ILSH + GAF +HCGWNS +E +S GVP++  P+ AEQ YN K++VE +G+ V +  GV++ +               +V+  IE+VMDK  +G+E + +A +IG   + ++ E G
Sbjct:   49 QLAELGLGLESTNQPFIWVIRE----GEKSEGLEKWILEEGYEER-KRKREDFWIRGWSPQVLILSHPAIGAFFTHCGWNSTLEGISAGVPIVACPLFAEQFYNEKLVVEVLGIGVSV--GVEAAVTWGLEDKCGAVMKKEQVKKAIEIVMDKGKEGEERRRRAREIGEMAKRTIEEGG 220          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: UFOG5_MANES (Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot esculenta GN=GT5 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.928e-28
Identity = 70/169 (41.42%), Postives = 102/169 (60.36%), Query Frame = -3
Query:  308 KLMALVIGLEASAKSFIWVIRPPI------GFDLRGEFRSE---WLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVEEMGVAVE-LTRGVQSTIVGHEVENVIEMVM-DKAG-----KGQEMKEKAEK 766
            +++ L  GLE S + FIWV+R P        F  +G+   +   + PEGF  RI+ V  GL+V  W+PQ+ I+SH S G FLSHCGWNSV+ES++ GVP+I WP+ AEQ  N+ +L EE+GVAV       +  +   E+E +I  +M D+ G     + +E+K+  EK
Sbjct:  288 QMIELAWGLERSQQRFIWVVRQPTVKTGDAAFFTQGDGADDMSGYFPEGFLTRIQNV--GLVVPQWSPQIHIMSHPSVGVFLSHCGWNSVLESITAGVPIIAWPIYAEQRMNATLLTEELGVAVRPKNLPAKEVVKREEIERMIRRIMVDEEGSEIRKRVRELKDSGEK 454          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: HQGT_RAUSE (Hydroquinone glucosyltransferase OS=Rauvolfia serpentina GN=AS PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 9.049e-28
Identity = 75/186 (40.32%), Postives = 104/186 (55.91%), Query Frame = -3
Query:  239 HPKLMALVIGLEASAKSFIWVIRPPIGFDLRGEFRS--------EWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVEEMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDGEDRGSSLKGL 772
            H + + L +GLE S + F+WV+R P        + S         +LPEGF ER K   + LLV +WAPQ EILSH STG FL+HCGWNS++ES+  GVP+I WP+ AEQ  N+ ML E + VA+    G    I   E+ N ++ +M+    G+E K K     + ++ +      D GSS K L
Sbjct:  278 HNQFIELALGLEMSEQRFLWVVRSPNDKIANATYFSIQNQNDALAYLPEGFLERTKG--RCLLVPSWAPQTEILSHGSTGGFLTHCGWNSILESVVNGVPLIAWPLYAEQKMNAVMLTEGLKVALRPKAGENGLIGRVEIANAVKGLME----GEEGK-KFRSTMKDLKDAASRALSDDGSSTKAL 456          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: ANGT_GENTR (Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.865e-27
Identity = 63/166 (37.95%), Postives = 100/166 (60.24%), Query Frame = -3
Query:  308 KLMALVIGLEASAKSFIWVIRPPIGFDLRGEFRSEWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVE--EMGVAV---ELTRGVQSTIV--GHEVENVIEMVM------DKAGKGQEMKEKAEK 766
            +L  L +GLE S + FIWV+R  +      E  S+W P+GFE+R++E  +GL+++ WAPQ+ IL H++ GAF+SHCGWNS +E +  GV ++ WP+ AEQ YN K++ +    GV+V   + +R   S +V     +   +  +M      D   + + +KEKA+K
Sbjct:  296 QLHELAMGLEESGQEFIWVVRTCVD----EEDESKWFPDGFEKRVQENNKGLIIKGWAPQVLILEHEAVGAFVSHCGWNSTLEGICGGVAMVTWPLFAEQFYNEKLMTDILRTGVSVGSLQWSRVTTSAVVVKRESISKAVRRLMAEEEGVDIRNRAKALKEKAKK 457          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: HQGT_ARATH (Probable hydroquinone glucosyltransferase OS=Arabidopsis thaliana GN=At4g01070 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.307e-26
Identity = 72/186 (38.71%), Postives = 104/186 (55.91%), Query Frame = -3
Query:  239 KLMALVIGLEASAKSFIWVIRPPIGFDLRGEFRSE-------WLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVEEMGVAVELTRGVQSTIVGHEVENVIEMVMD-KAGKG--QEMKEKAEKIGRQIRGSMIEDGEDRGSSLKGL 766
            +L  L +GL  S + F+WVIR P G      F S        +LP GF ER K  K+G ++  WAPQ ++L+H STG FL+HCGWNS +ES+  G+P+I WP+ AEQ  N+ +L E++  A+    G    +   EV  V++ +M+ + GKG   +MKE  E   R ++        D G+S K L
Sbjct:  285 QLNELALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTK--KRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLK--------DDGTSTKAL 460          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: CZOG_SORBI (Putative cis-zeatin O-glucosyltransferase OS=Sorghum bicolor GN=SB20O07.14 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.911e-26
Identity = 69/182 (37.91%), Postives = 104/182 (57.14%), Query Frame = -3
Query:  227 LVIGLEASAKSFIWVIRPP----IGFDLRGEFRSEWLPEGFEERIKEVKQGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVE--EMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDGEDRGSSLKGLDDFV 754
            L   ++ S + FIWV+R      I  D  GE R       F E  + +  GLL+  WAPQLEIL+H +T AF+SHCGWNS +ESLS G PV+ WPM ++Q ++S++L +  + G+ V         I    ++ VIE  M  +  G  ++++A+++G  +R S+     D G+S K LDDF+
Sbjct:  287 LAAAIKGSKQRFIWVLRDADRADIYADASGESRHAKFLSEFTEETRGI--GLLITGWAPQLEILAHGATAAFMSHCGWNSTMESLSHGKPVLAWPMHSDQPWDSELLCKYLKAGLLVRPWEKHADIIPAQAIQKVIEEAM-LSDSGMAVRQRAKELGEAVRASV----ADGGNSRKDLDDFI 461          
BLAST of DT214516 vs. ExPASy Swiss-Prot
Match: CZOG2_MAIZE (Cis-zeatin O-glucosyltransferase 2 OS=Zea mays GN=CISZOG2 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.911e-26
Identity = 67/179 (37.43%), Postives = 103/179 (57.54%), Query Frame = -3
Query:  227 LVIGLEASAKSFIWVIRPPIGFDLRGEFRSEWLPEGFEERIKEVK-QGLLVRNWAPQLEILSHKSTGAFLSHCGWNSVIESLSQGVPVIGWPMAAEQAYNSKMLVE--EMGVAVELTRGVQSTIVGHEVENVIEMVMDKAGKGQEMKEKAEKIGRQIRGSMIEDGEDRGSSLKGLDDFV 754
            L   L+ S + F+WV+R     D+  E       +   E  +E +  GL+V  WAPQLEIL+H +T AF+SHCGWNS+IESLS G PV+ WPM ++Q ++S++L    + G+ V         I    ++ VIE  M  +  G  ++++A+++G  +R S+     D G+S K LDDF+
Sbjct:  285 LAAALKGSKQRFVWVLRDADRADIYAESGDSRHAKFLSEFTRETEGTGLVVTGWAPQLEILAHGATAAFMSHCGWNSIIESLSHGKPVLAWPMHSDQPWDSELLCNYFKAGLLVRPWEKHAEIIPAQAIQKVIEEAM-LSDSGMAVRQRAKELGEAVRASV----ADGGNSRKDLDDFI 458          
The following BLAST results are available for this feature:
BLAST of DT214516 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
ZOG_PHALU2.813e-2941.18Zeatin O-glucosyltransferase OS=Phaseolus lunatus ... [more]
ZOX_PHAVU3.674e-2940.46Zeatin O-xylosyltransferase OS=Phaseolus vulgaris ... [more]
ANGLT_ROSHC3.674e-2940.45Anthocyanidin 5,3-O-glucosyltransferase OS=Rosa hy... [more]
UFOG4_MANES6.266e-2938.55Anthocyanidin 3-O-glucosyltransferase 4 (Fragment)... [more]
UFOG5_MANES6.928e-2841.42Anthocyanidin 3-O-glucosyltransferase 5 OS=Manihot... [more]
HQGT_RAUSE9.049e-2840.32Hydroquinone glucosyltransferase OS=Rauvolfia serp... [more]
ANGT_GENTR5.865e-2737.95Anthocyanin 3'-O-beta-glucosyltransferase OS=Genti... [more]
HQGT_ARATH1.307e-2638.71Probable hydroquinone glucosyltransferase OS=Arabi... [more]
CZOG_SORBI2.911e-2637.91Putative cis-zeatin O-glucosyltransferase OS=Sorgh... [more]
CZOG2_MAIZE2.911e-2637.43Cis-zeatin O-glucosyltransferase 2 OS=Zea mays GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_36E04_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-36E04-J8-1-4.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214516 ID=DT214516|Name=DT214516|organism=Citrus sinensis|type=EST|length=780bp
ATATTGATGCCTATATAATAATGCACAGAAAAAGCAGATGAAATTGGAAA
CTCCTGCATTTATCAAATTGTTCGAAAAAGAAGGTAACGCACGCAAACAA
CTGATAAGACTTTGCACATTGCAACTCCAAATACAATTATTAAGTTAGGG
GAAGACTTATTACCTCAATTGTCTGCAATGTGGGATATTACACCGATTGA
TCTTGTCTTCTTAACAAAATGGACCTAACAAAATCATCCAATCCTTTTAA
AGAGGATCCTCTGTCTTCTCCATCCTCTATCATTGATCCCCTTATTTGCC
TTCCAATTTTTTCAGCTTTCTCCTTCATTTCTTGCCCCTTCCCTGCCTTG
TCCATCACCATTTCTATCACATTTTCCACCTCGTGTCCTACAATCGTACT
TTGAACTCCTCTTGTCAACTCTACAGCCACCCCCATTTCCTCAACAAGCA
TCTTTGAATTATAAGCCTGCTCTGCTGCCATTGGCCAACCAATCACTGGC
ACTCCTTGGCTTAAACTTTCTATCACTGAATTCCAGCCACAGTGGCTCAA
GAATGCTCCTGTTGATTTGTGTGACAAAATCTCCAACTGGGGTGCCCAGT
TTCTCACCAACAAACCTTGTTTAACTTCTTTGATTCTTTCTTCAAATCCC
TCAGGCAACCATTCTGATCTAAATTCACCTCTCAAGTCAAAACCAATAGG
CGGCCTAATGACCCAGATGAAAGATTTAGCACTTGCTTCCAAACCAATGA
CCAGTGCCATCAATTTGGGATGAACTTATT
back to top