DT214510

Overview
NameDT214510
Unique NameDT214510
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length722
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_CAPAN (Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Capsicum annuum GN=TKT2 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.261e-49
Identity = 94/144 (65.28%), Postives = 115/144 (79.86%), Query Frame = -2
Query:  161 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREALLLM 592
            E+GKG++ VEG+ VALLGYG+ VQNCL A ++L   G+ VTVADARFCKPLD  L+R L ++H  L+TVE+GS+GGFGSHV  F+ALDGLLD  +KWRPIVLPD YI+H SP  QLA AGLT  HIAAT  ++LG+TREAL +M
Sbjct:  575 EVGKGRILVEGERVALLGYGSAVQNCLAAASVLESRGLQVTVADARFCKPLDRALIRSLAKSHEVLVTVEKGSIGGFGSHVVQFMALDGLLDGKLKWRPIVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNILGQTREALEVM 718          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_ORYSJ (Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=CLA1 PE=2 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 1.820e-48
Identity = 92/144 (63.89%), Postives = 114/144 (79.17%), Query Frame = -2
Query:  161 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREALLLM 592
            E+GKG+V +EG+ VALLGYG+ VQ CL A +L+ + G+ VTVADARFCKPLD  L+R L  +H  L+TVEEGS+GGFGSHV+ F+ALDGLLD  +KWRP+VLPD YI+H SP  QLA AGLT  HIAAT  ++LG+ REAL +M
Sbjct:  572 EVGKGRVLLEGERVALLGYGSAVQYCLAAASLVERHGLKVTVADARFCKPLDQTLIRRLASSHEVLLTVEEGSIGGFGSHVAQFMALDGLLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNVLGQAREALAIM 715          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_ARATH (Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=CLA1 PE=1 SV=2)

HSP 1 Score: 189.504 bits (480), Expect = 1.541e-47
Identity = 92/141 (65.25%), Postives = 112/141 (79.43%), Query Frame = -2
Query:  170 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREAL 592
            EIGKG++  EG+ VALLGYG+ VQ+CL A  +L + G++VTVADARFCKPLD  L+R L ++H  LITVEEGS+GGFGSHV  F+ALDGLLD  +KWRP+VLPD YI+H +P  QLA AGL   HIAATAL+L+G  REAL
Sbjct:  576 EIGKGRILKEGERVALLGYGSAVQSCLGAAVMLEERGLNVTVADARFCKPLDRALIRSLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIDHGAPADQLAEAGLMPSHIAATALNLIGAPREAL 716          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_RHIL3 (1-deoxy-D-xylulose-5-phosphate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dxs PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.072e-32
Identity = 70/136 (51.47%), Postives = 92/136 (67.65%), Query Frame = -2
Query:  185 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGR 592
            +IGKG++  EG  VALL +G  + +CL A   L   G+  TVADARF KPLD  L+R+L ++H  +ITVEEGS+GGFGSHV HF+A +GLLD+G+K R +V+PD ++E A P    A AGL    I +T    LGR
Sbjct:  495 QIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFGSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFKALGR 630          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_RHILO (1-deoxy-D-xylulose-5-phosphate synthase OS=Rhizobium loti GN=dxs PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.400e-32
Identity = 71/140 (50.71%), Postives = 92/140 (65.71%), Query Frame = -2
Query:  173 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREA 592
            E+GKG+V  EG  VALL +G  +Q+CL A   L   G+  TVADARF KPLD  L+R L ++H  L+TVEEG++GGF SHV  F+A +GLL+SG+K RP+VLPD + +HA P +  A AGL    I  T  + L  T  A
Sbjct:  495 ELGKGRVVREGSKVALLSFGTRLQDCLIAAEELGAAGLSTTVADARFAKPLDEDLIRRLARSHEVLVTVEEGAIGGFASHVLQFLAHEGLLESGLKVRPLVLPDVFTDHAKPEKMYADAGLDAAGIVRTVFTALDHTARA 634          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_RHOCS (1-deoxy-D-xylulose-5-phosphate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dxs PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.388e-32
Identity = 71/135 (52.59%), Postives = 90/135 (66.67%), Query Frame = -2
Query:  188 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLG 592
            EIGKG++  EG  VA+L  G  ++  L A   L+  G+  TVADARF KP+D  L+R L Q+H  LITVEEGS+GGFGS+V HF+A  GLLD G+K RP+VLPD + +  +P +Q   AGL   HI  TAL  LG
Sbjct:  496 EIGKGRIVKEGTKVAILSLGTRLKEALLAAEDLNARGLSTTVADARFAKPIDEALIRRLAQDHEVLITVEEGSIGGFGSYVLHFLAQSGLLDQGLKVRPMVLPDIFQDQDAPAKQYDEAGLNARHIVETALKALG 630          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_MESSB (1-deoxy-D-xylulose-5-phosphate synthase OS=Mesorhizobium sp. (strain BNC1) GN=dxs PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.074e-32
Identity = 66/140 (47.14%), Postives = 93/140 (66.43%), Query Frame = -2
Query:  173 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREA 592
            +IGKG++  EG  +ALL  G  + +C+ A   L   G+  TVADARF KPLD  L+R L + H  L+TVEEGS+GGFG+HV HF+A +GLL++G+K RP+V+PD +++ A P +  A AGL    I  T  + LG+  +A
Sbjct:  508 KIGKGRIVREGSKIALLSLGTRLADCMIAAEELEAAGLSTTVADARFAKPLDADLIRRLAREHEVLVTVEEGSIGGFGAHVLHFLAHEGLLENGLKVRPLVMPDIFMDQAKPEKMYAKAGLDAAGIVKTVFAALGQAEQA 647          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_AGRT5 (1-deoxy-D-xylulose-5-phosphate synthase OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=dxs PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.022e-31
Identity = 67/136 (49.26%), Postives = 88/136 (64.71%), Query Frame = -2
Query:  185 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGR 592
            +IGKG++  EG  VALL +G  +  CL A   L   G+  TVADARF KPLD+ L+R+L  +H  L+T+EEGS+GGFG+HV HF+A  GLLD G K R + LPD ++E A P    A AGL    I +T  + LG+
Sbjct:  495 QIGKGRIIKEGTKVALLSFGTRLAECLAAAEDLDAAGLSTTVADARFAKPLDLDLIRQLAAHHEVLVTIEEGSVGGFGAHVLHFMASAGLLDHGPKVRTLTLPDQWVEQAKPETMYANAGLDRAGIVSTVFNALGQ 630          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS_BEII9 (1-deoxy-D-xylulose-5-phosphate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dxs PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.449e-31
Identity = 72/141 (51.06%), Postives = 93/141 (65.96%), Query Frame = -2
Query:  173 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLD-SGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREA 592
            +IG+G++  EG  VALL  G  +    KA   L+  GI VTVADARF KPLD+ LVR L +NH  LIT+EEGS+GGFGS V   +A +GLLD +G+K+R +VLPD +++H  P +  A AGL    I A  L+ LGR  EA
Sbjct:  496 DIGRGRIVREGTTVALLSLGTRLAEASKAAEQLASYGISVTVADARFAKPLDLDLVRRLAKNHEVLITIEEGSVGGFGSFVMQALAEEGLLDGTGLKFRSMVLPDTFLDHDKPEKLYAQAGLDAKGIVAKVLATLGRENEA 636          
BLAST of DT214510 vs. ExPASy Swiss-Prot
Match: DXS1_RHOS4 (1-deoxy-D-xylulose-5-phosphate synthase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dxs1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.683e-31
Identity = 71/148 (47.97%), Postives = 93/148 (62.84%), Query Frame = -2
Query:  149 EIGKGKVFVEGKDVALLGYGAMVQNCLKARALLSKLGIDVTVADARFCKPLDIKLVRELCQNHTFLITVEEGSLGGFGSHVSHFIALDGLLDSGVKWRPIVLPDNYIEHASPTQQLALAGLTGHHIAATALSLLGRTREALLLMC*KP 592
            E G+G+V  EG DVA+L +GA +   L+A  LL   G+ VTVADARF +PLD  L+ +L ++H  L+TVE+G++GGFG+HV H++A  G  D G+  R + LPD +IE ASP    A AGL    IAATA   L R R   L    KP
Sbjct:  498 EPGRGRVVREGTDVAILSFGAHLHEALQAAKLLEAEGVSVTVADARFSRPLDTGLIDQLVRHHAALVTVEQGAMGGFGAHVMHYLANSGGFDGGLALRVMTLPDRFIEQASPEDMYADAGLRAEDIAATARGALARGRVMPLRQTAKP 645          
The following BLAST results are available for this feature:
BLAST of DT214510 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 283
Match NameE-valueIdentityDescription
DXS_CAPAN1.261e-4965.28Probable 1-deoxy-D-xylulose-5-phosphate synthase, ... [more]
DXS_ORYSJ1.820e-4863.89Probable 1-deoxy-D-xylulose-5-phosphate synthase, ... [more]
DXS_ARATH1.541e-4765.25Probable 1-deoxy-D-xylulose-5-phosphate synthase, ... [more]
DXS_RHIL31.072e-3251.471-deoxy-D-xylulose-5-phosphate synthase OS=Rhizobi... [more]
DXS_RHILO1.400e-3250.711-deoxy-D-xylulose-5-phosphate synthase OS=Rhizobi... [more]
DXS_RHOCS2.388e-3252.591-deoxy-D-xylulose-5-phosphate synthase OS=Rhodosp... [more]
DXS_MESSB4.074e-3247.141-deoxy-D-xylulose-5-phosphate synthase OS=Mesorhi... [more]
DXS_AGRT52.022e-3149.261-deoxy-D-xylulose-5-phosphate synthase OS=Agrobac... [more]
DXS_BEII93.449e-3151.061-deoxy-D-xylulose-5-phosphate synthase OS=Beijeri... [more]
DXS1_RHOS47.683e-3147.971-deoxy-D-xylulose-5-phosphate synthase 1 OS=Rhodo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_21F06_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-21F06-K11-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214510 ID=DT214510|Name=DT214510|organism=Citrus sinensis|type=EST|length=722bp
TTAATTTACAATGACGTACCCAACATTAAGAAAAACAGTTGATCTATATT
TGGTTCTTGCCCTCTCTTATGTTTTTGTTGTTCCCTCATCCTTTCTAATA
AGTGAATTTACCAATCTGGGAAACTCAAATGCCAAAAAGAAAACTCGGGG
GTTTCTAGCACATTAAAAGGAGGGCTTCACGGGTGCGCCCGAGCAAACTT
AATGCTGTAGCAGCAATGTGATGTCCAGTGAGTCCCGCAAGAGCAAGCTG
TTGGGTTGGTGATGCATGTTCAATATAGTTGTCTGGTAAAACAATTGGTC
TCCACTTAACTCCTGAATCAAGCAGTCCGTCAAGGGCAATGAAGTGTGAA
ACATGTGAACCAAATCCTCCAAGGGAGCCTTCCTCAACTGTTATCAAAAA
TGTATGGTTTTGACAAAGCTCCCTGACCAGCTTAATATCTAGGGGCTTGC
AAAATCTTGCATCAGCCACAGTAACATCAATGCCAAGCTTTGAAAGAAGG
GCCCGAGCTTTCAGGCAGTTCTGAACCATTGCCCCATATCCAAGCAAAGC
AACATCTTTGCCCTCTACAAAAACTTTCCCTTTTCCAATCTCCTCAAATC
AAATTCAAGCAAAGTTTGAAAATGACTAATGAAGAATAATAAAAAAGCAA
AATGGAATATGCAAGTAAGTCATAAAATTGATAAAAATAACTTAATATTT
TGGACAATGTTTACCTTAACCC
back to top