DT214507

Overview
NameDT214507
Unique NameDT214507
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length886
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6525 contig Csv1_Contig6525:1..886. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_ARATH (Vacuolar protein sorting-associated protein 25 OS=Arabidopsis thaliana GN=VPS25 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.098e-50
Identity = 97/112 (86.61%), Postives = 106/112 (94.64%), Query Frame = -2
Query:   88 SLNNEARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKFSV 423
            SL++EARETFLSA+V EGRAEWLDKGHRKCLILWHRIQDWADI+L FV+DNGLEDSVMTVEEIR G ES GTEL G+DRTILMRALKLLE+KGK+A+FKGTSADDEGVKFSV
Sbjct:   68 SLSHEARETFLSAIVGEGRAEWLDKGHRKCLILWHRIQDWADIVLQFVRDNGLEDSVMTVEEIRSGTESLGTELQGIDRTILMRALKLLENKGKLALFKGTSADDEGVKFSV 179          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_DANRE (Vacuolar protein-sorting-associated protein 25 OS=Danio rerio GN=vps25 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 8.326e-15
Identity = 41/109 (37.61%), Postives = 64/109 (58.72%), Query Frame = -2
Query:   94 LNNEARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 420
            L+ EA +     L  +G  EWLDK   +CLI+W R ++W  +I  +V  NG+ +SV T+ E+  G ++   E HG++  +L+R+L+ L+  GK  I   T  D +GVKF
Sbjct:   67 LSVEAIQVVFEELRKKGNLEWLDKNKSRCLIMWRRPEEWGKLIYQWVSKNGMVNSVFTLYELANGDDTEKEEFHGLEDWMLLRSLQALQTDGKAEII--TMDDGKGVKF 173          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_XENLA (Vacuolar protein-sorting-associated protein 25 OS=Xenopus laevis GN=vps25 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.132e-14
Identity = 39/109 (35.78%), Postives = 63/109 (57.80%), Query Frame = -2
Query:   94 LNNEARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 420
            L+ E+ +  L  L  +G  EW+DK   + LI+W R  +W  +I  +V  NG+ +SV T+ E+  G ++ G E HG+D  +L+R+L+ L+ + K  I   T  +  GVKF
Sbjct:   67 LSLESVQVVLEELRKKGNLEWIDKNKSRFLIMWRRPDEWGKVIYQWVSKNGMTNSVFTLYELISGDDTEGEEFHGLDEAMLLRSLEALQQEHKAEII--TLNESRGVKF 173          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_BOVIN (Vacuolar protein-sorting-associated protein 25 OS=Bos taurus GN=VPS25 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.498e-13
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = -2
Query:   94 EARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 411
            E+ +  L  L  +G  EWLDK     LI+W R ++W  +I  +V  +G  +SV T+ E+  G ++   E HG+D   L+RAL+ L+ + K  I   T +D  GVKF
Sbjct:   72 ESIQVVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSKSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEII--TVSDGRGVKF 175          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_MOUSE (Vacuolar protein-sorting-associated protein 25 OS=Mus musculus GN=Vps25 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.568e-13
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = -2
Query:   94 EARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 411
            E+ +  L  L  +G  EWLDK     LI+W R ++W  +I  +V  +G  +SV T+ E+  G ++   E HG+D   L+RAL+ L+ + K  I   T +D  GVKF
Sbjct:   72 ESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEII--TVSDGRGVKF 175          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_DICDI (Vacuolar protein-sorting-associated protein 25 OS=Dictyostelium discoideum GN=vps25 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.568e-13
Identity = 42/122 (34.43%), Postives = 71/122 (58.20%), Query Frame = -2
Query:   94 LNNEARETFLSALVSEGRAEWLDK-------------GHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 420
            L+ EA ++ +  ++  G AEW+DK              + + LI+W +  +WA +I  +V D GL ++V+TV EI+ G +S+  E H ++ TILM++LK+LE + K   F  +  ++ GVKF
Sbjct:   72 LSREALKSIIDDIIENGFAEWVDKEKEKEKEKDKDNNNNNRVLIMWRKPDEWASLIYKWVADCGLLNTVLTVWEIQNGDDSKKQEFHQLNTTILMKSLKVLEKQSKCQTF--SQDENVGVKF 191          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_RAT (Vacuolar protein-sorting-associated protein 25 OS=Rattus norvegicus GN=Vps25 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.967e-13
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = -2
Query:   94 EARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 411
            E+ +  L  L  +G  EWLDK     LI+W R ++W  +I  +V  +G  +SV T+ E+  G ++   E HG+D   L+RAL+ L+ + K  I   T +D  GVKF
Sbjct:   72 ESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEII--TVSDGRGVKF 175          
BLAST of DT214507 vs. ExPASy Swiss-Prot
Match: VPS25_HUMAN (Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens GN=VPS25 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.967e-13
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = -2
Query:   94 EARETFLSALVSEGRAEWLDKGHRKCLILWHRIQDWADIILGFVKDNGLEDSVMTVEEIRLGIESRGTELHGMDRTILMRALKLLEHKGKVAIFKGTSADDEGVKF 411
            E+ +  L  L  +G  EWLDK     LI+W R ++W  +I  +V  +G  +SV T+ E+  G ++   E HG+D   L+RAL+ L+ + K  I   T +D  GVKF
Sbjct:   72 ESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEII--TVSDGRGVKF 175          
The following BLAST results are available for this feature:
BLAST of DT214507 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
VPS25_ARATH2.098e-5086.61Vacuolar protein sorting-associated protein 25 OS=... [more]
VPS25_DANRE8.326e-1537.61Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_XENLA4.132e-1435.78Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_BOVIN3.498e-1336.79Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_MOUSE4.568e-1336.79Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_DICDI4.568e-1334.43Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_RAT5.967e-1336.79Vacuolar protein-sorting-associated protein 25 OS=... [more]
VPS25_HUMAN5.967e-1336.79Vacuolar protein-sorting-associated protein 25 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_17E05_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-17E05-I9-1-4.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214507 ID=DT214507|Name=DT214507|organism=Citrus sinensis|type=EST|length=886bp
TAACAATATCAAATTAACAAAGGCAGCGAGATGTGATCCAACAAGTTCAG
TTAAGTCAATTTGAAATTTATCCAGTAATGTACATTACACAGAGAATTTC
ACGCCTTCATCATCAGCTGATGTCCCTTTAAATATTGCAACCTTCCCTTT
GTGTTCAAGTAGTTTCAACGCTCGCATTAAAATTGTGCGGTCCATCCCAT
GAAGCTCTGTCCCTCGAGATTCAATCCCTAAACGTATTTCCTCCACAGTC
ATAACACTATCCTCCAACCCATTGTCTTTTACAAAGCCTAAAATAATGTC
AGCCCAATCTTGAATCCGGTGCCAAAGGATAAGGCATTTCCTATGTCCTT
TATCCAACCACTCTGCCCGACCTTCTGACACTAAAGCAGACAGGAATGTT
TCTCTAGCTTCATTATTAAGAGATCCTGCATGAAACAATCATAACGATAA
TTTGATTAGAGACGGTAATTTGGATGCAGCAGAGTAATAGGTAGTGACGC
TCTTGAGTTAATAACTCAAAAAATCAATGCTTTTGTGAATTACCAAGAAA
AATTTAATTTCAGTACTAACTCATGAACCTTCATGGTCCAGAAAAAGGGG
CAACCAAACCTTTTGTTGTAGTATATTGGCCAAACAATCAGGCAGAAAGG
AGGGAAAGGATCTAATCAGCCATTATGGCAAATAGCATGTCACCCTCAAT
ATACACAGCCACAGAAATAGCTTGACTCCTCAGAACCTTCACAGTATCAC
TTCAGAAGTTTGATTATAAGAGAATTAAGCTTGCTGACTTTCAGATGCAG
CAGTAATTTAAGAATTTTCCTTCTATTATACACCATAAATATCACTTTAC
AAATAGACGGTAATGATTATTATCAGTAGAAAATAA
back to top