DT214506

Overview
NameDT214506
Unique NameDT214506
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length540
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4323 contig Csv1_Contig4323:43..582. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5_MOUSE (Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.984e-25
Identity = 62/137 (45.26%), Postives = 85/137 (62.04%), Query Frame = -2
Query:  156 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSGTNRLR--------SLKTLPTKSTPVYSLQFSRRNLLFAAGALS 539
            VRIF GH+  I SL  SP+GR++A+G  DG +++WD+  G  V  L GHT  V +L +S +G +LASGS D TV+LWD   + + L+T++  + T  +          L T  TKSTPV  L F+RRNL+ AAGA S
Sbjct:  663 VRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAVKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYS 799          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5_HUMAN (Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3)

HSP 1 Score: 113.235 bits (282), Expect = 7.815e-25
Identity = 62/137 (45.26%), Postives = 85/137 (62.04%), Query Frame = -2
Query:  156 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEE-KSGTNRLR--------SLKTLPTKSTPVYSLQFSRRNLLFAAGALS 539
            VRIF GH+  I SL  SP+GR++A+G  DG +++WD+  G  V  L GHT  V +L +S +G +LASGS D TV+LWD   + + L+T++  + T  +          L T  TKSTPV  L F+RRNL+ AAGA S
Sbjct:  662 VRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYS 798          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5_DROME (Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.796e-20
Identity = 50/132 (37.88%), Postives = 76/132 (57.58%), Query Frame = -2
Query:  165 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTK-------VLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAG 539
            VR+  GH+  + SLA S  GRY+ASG  D  I++WDL++G  VT L+ HTS V T+ +S +G++LA+   D  + LWD    T+        +   +      +  ++T P+K++P  SL F+RRNLL   G
Sbjct:  569 VRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVTEDYISNHITVSHHQDENDEDVYLMRTFPSKNSPFVSLHFTRRNLLMCVG 700          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5_SCHPO (Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe GN=taf5 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 9.886e-20
Identity = 50/142 (35.21%), Postives = 79/142 (55.63%), Query Frame = -2
Query:  171 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDV------------TTSTKVLKTEEKSGTNRLRSLKTLP-------TKSTPVYSLQFSRRNLLFA 539
            VR+F GH   + ++A++PDG  MAS D +G I +WD+ +GR +  + GH   +++L++S E ++L SG +DCTV+ WDV             T + V     K+ T    +  T P       TK TP++++ F+RRNL  A
Sbjct:  498 VRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFNEVNWSTSPDQMVALYTKQTPIFNVSFTRRNLCLA 639          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5_YEAST (Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae GN=TAF5 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.291e-19
Identity = 52/152 (34.21%), Postives = 87/152 (57.24%), Query Frame = -2
Query:  162 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGH-TSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTE--------------------EKSGTNRL-----RSLKTLPTKSTPVYSLQFSRRNLLFAAGA 539
            VR+F+GH + ++S+A+ PDGR++++G EDG I +WD+ +G+ +  + GH  + +++L+YS EG++L SG AD TV++WD+  +T     E                    ++ G  R        + +  TK TPV+ ++FSR NL  A GA
Sbjct:  644 VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQDIKEYGRRRTVIPTSDLVASFYTKKTPVFKVKFSRSNLALAGGA 795          

HSP 2 Score: 70.0922 bits (170), Expect = 7.587e-12
Identity = 42/127 (33.07%), Postives = 68/127 (53.54%), Query Frame = -2
Query:  162 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRR-NLLFAAGA 539
            +RIF GH + +  ++  P+G Y+ +G  D T  MWD+++G  V   +GHT+ V ++A   +G  L++GS D  + +WD+ T  K LK     G N              +YSL +S+  N+L + GA
Sbjct:  602 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG-KRLKQMRGHGKN-------------AIYSLSYSKEGNVLISGGA 714          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5L_MOUSE (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.153e-18
Identity = 48/125 (38.40%), Postives = 72/125 (57.60%), Query Frame = -2
Query:  165 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAG 539
            VR+F GHR  +LSL+ SP+G+Y+AS  ED  + +WDLASG     L GHT  + +LA+S +  L+AS S D +V++WD+ ++      +  SG      +     + + V S+QF   NLL   G
Sbjct:  461 VRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRSTCCNTPADGSSG----ELVGVYTGQMSNVLSVQFMACNLLLVTG 581          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: HETE1_PODAN (Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.061e-17
Identity = 42/88 (47.73%), Postives = 55/88 (62.50%), Query Frame = -2
Query:  261 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSG 524
            GH S +LS+A SPDG+ +ASG  D TI +WD ASG C   L GH   VW++A+S +G  +ASGS D T+K+WD  + T     E   G
Sbjct:  965 GHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGG 1052          

HSP 2 Score: 85.5001 bits (210), Expect = 1.745e-16
Identity = 52/139 (37.41%), Postives = 72/139 (51.80%), Query Frame = -2
Query:  108 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS*KIYAERDGRVQQ 524
            GH   + S+A SPDG+ +ASG +D TI +WD ASG C   L GH S V ++A+S +G  +ASGS D T+K+WD  + T     E   G+               V+S+ FS      A+G+  KT  KI+    G   Q
Sbjct:  923 GHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGS---------------VWSVAFSPDGQRVASGSDDKTI-KIWDTASGTCTQ 1045          

HSP 3 Score: 83.9593 bits (206), Expect = 5.077e-16
Identity = 49/139 (35.25%), Postives = 69/139 (49.64%), Query Frame = -2
Query:  108 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS*KIYAERDGRVQQ 524
            GH   + S+  SPDG+ +ASG +D TI +WD  SG C   L GH   VW++A+S +G  +ASGS D T+K+WD  + T     E   G                V+S+ FS      A+G++  T  KI+    G   Q
Sbjct: 1049 GHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGW---------------VHSVAFSPDGQRVASGSIDGTI-KIWDAASGTCTQ 1171          

HSP 4 Score: 82.8037 bits (203), Expect = 1.131e-15
Identity = 52/139 (37.41%), Postives = 69/139 (49.64%), Query Frame = -2
Query:  108 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS*KIYAERDGRVQQ 524
            GH   + S+A SPDG+ +ASG  DGTI +WD ASG C   L GH   V ++A+S +G  +ASGS D T+K+WD  + T     E   G                V S+ FS      A+G+  KT  KI+    G   Q
Sbjct: 1091 GHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGW---------------VQSVAFSPDGQRVASGSSDKTI-KIWDTASGTCTQ 1213          

HSP 5 Score: 82.8037 bits (203), Expect = 1.131e-15
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = -2
Query:  261 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSG 524
            GH   + S+A SPDG+ +ASG  DGTI +WD ASG C   L GH   V ++A+S +G  +ASGS+D T+K+WD  + T     E   G
Sbjct: 1133 GHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGHGG 1220          

HSP 6 Score: 80.8777 bits (198), Expect = 4.298e-15
Identity = 49/139 (35.25%), Postives = 70/139 (50.36%), Query Frame = -2
Query:  108 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS*KIYAERDGRVQQ 524
            GH   + S+A SPDG+ +ASG +D TI +WD ASG C   L GH   V ++ +S +G  +ASGS D T+K+WD  + T                 +TL      V+S+ FS      A+G++  T  KI+    G   Q
Sbjct: 1007 GHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGT---------------CTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTI-KIWDAASGTCTQ 1129          

HSP 7 Score: 80.8777 bits (198), Expect = 4.298e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = -2
Query:  291 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTST 524
            GH   + S+A SPDG+ +ASG  D TI +WD ASG C   L GH   V ++A+S +G  +ASGS+D T+K+WD  + T
Sbjct: 1175 GHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIWDTASGT 1252          

HSP 8 Score: 79.7221 bits (195), Expect = 9.575e-15
Identity = 42/99 (42.42%), Postives = 59/99 (59.60%), Query Frame = -2
Query:  228 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLP 524
            GH S +LS+A S DG+ +ASG +D TI +WD ASG     L GH   VW++A+S +   +ASGS D T+K+WD  + T     E   G  R++S+   P
Sbjct:  839 GHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGG--RVQSVAFSP 935          

HSP 9 Score: 78.5666 bits (192), Expect = 2.133e-14
Identity = 50/139 (35.97%), Postives = 69/139 (49.64%), Query Frame = -2
Query:  108 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS*KIYAERDGRVQQ 524
            GH   + S+A SPD   +ASG +D TI +WD ASG C   L GH   V ++A+S +G  +ASGS D T+K+WD  + T                 +TL    + V S+ FS      A+G+  KT  KI+    G   Q
Sbjct:  881 GHGGSVWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGT---------------CTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTI-KIWDTASGTCTQ 1003          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: TAF5L_HUMAN (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.592e-17
Identity = 48/125 (38.40%), Postives = 71/125 (56.80%), Query Frame = -2
Query:  165 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAG 539
            VR+F GHR  +LSLA SP+G+Y+AS  ED  + +WDLASG     L GHT  + +L +S +  L+AS S D +V++WD+  +           ++ L  + T   + + V S+QF   NLL   G
Sbjct:  461 VRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNT--YCSAPADGSSSELVGVYT--GQMSNVLSVQFMACNLLLVTG 581          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: YY46_ANASP (Uncharacterized WD repeat-containing protein alr3466 OS=Anabaena sp. (strain PCC 7120) GN=alr3466 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.998e-17
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = -2
Query:  297 IFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTT 533
            IF GH S + S+  S DG  +ASG +D T+ +WD++SG C+  L GHTSCV ++ +S +G++LASG  D  V+LWD+++
Sbjct: 1027 IFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISS 1105          

HSP 2 Score: 85.5001 bits (210), Expect = 1.745e-16
Identity = 40/87 (45.98%), Postives = 60/87 (68.97%), Query Frame = -2
Query:  270 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTS--TKVLKTEE 524
            GH + + S+  SPDG  +ASG +D T+ +W+++SG C+  L GH + V ++A+S +G +LASGS D T+KLWDV T    K LK+E+
Sbjct: 1408 GHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVKTGECIKTLKSEK 1494          

HSP 3 Score: 85.1149 bits (209), Expect = 2.279e-16
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -2
Query:  294 VRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTS 539
            ++ F GH S + S+  SP+   +ASG  D T+ +WD++SG C+    GHT  V+++A++ +GS+LA+GS D TV+LWD+++S
Sbjct:  941 LKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDISSS 1022          

HSP 4 Score: 85.1149 bits (209), Expect = 2.279e-16
Identity = 44/127 (34.65%), Postives = 74/127 (58.27%), Query Frame = -2
Query:  150 FIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 530
            F GH S + S+  +PDG  +ASG  D T+ +WD++S +C+    GHT+ V ++A++ +GS+LASGS D TV+LW++++S               + L T    ++ V S+ FS    + A+G+  +T
Sbjct: 1238 FQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSS---------------KCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQT 1349          

HSP 5 Score: 85.1149 bits (209), Expect = 2.279e-16
Identity = 45/127 (35.43%), Postives = 72/127 (56.69%), Query Frame = -2
Query:  150 FIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 530
            F GH S + S+  SPDG  +ASG +D T+ +W ++SG C+   +GHT+ V ++ +S +G++LASGS D TV+LW +++                + L TL   +  V S+ FS    L A+G+  +T
Sbjct: 1322 FQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSISSG---------------KCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQT 1433          

HSP 6 Score: 84.7297 bits (208), Expect = 2.977e-16
Identity = 45/127 (35.43%), Postives = 72/127 (56.69%), Query Frame = -2
Query:  150 FIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 530
            F+GH + + S+  SPDG  +ASG  D T+ +W ++SG+C+  L GH + V ++ +S +G+LLASGS D TV+LW++++                  L TL      V S+ FS   L+ A+G+  +T
Sbjct: 1364 FLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSG---------------ECLYTLHGHINSVRSVAFSSDGLILASGSDDET 1475          

HSP 7 Score: 83.1889 bits (204), Expect = 8.660e-16
Identity = 44/123 (35.77%), Postives = 69/123 (56.10%), Query Frame = -2
Query:  165 IFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAG 533
            IF GH   + S+A + DG  +A+G  D T+ +WD++S +C     GHTSCV ++ +S +G++LASGS D TV+LWD+++                  L TL   ++ V S+ FS    + A+G
Sbjct:  985 IFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSG---------------NCLYTLQGHTSCVRSVVFSPDGAMLASG 1092          

HSP 8 Score: 82.0333 bits (201), Expect = 1.929e-15
Identity = 44/125 (35.20%), Postives = 73/125 (58.40%), Query Frame = -2
Query:  150 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 524
            GH + + ++A SPDG  +ASG  D T+ +WD++S +C+  L GHTS V ++ ++ +GS LASGS+D TV+LW++ +S               + L T    ++ V S+ F+    + A+G+  KT
Sbjct: 1156 GHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSS---------------KCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKT 1265          

HSP 9 Score: 82.0333 bits (201), Expect = 1.929e-15
Identity = 43/105 (40.95%), Postives = 67/105 (63.81%), Query Frame = -2
Query:  219 IFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKS 533
            I  GH S + S+  +PDG  +ASG  D T+ +W++ S +C+    GHTS V ++ ++ +GS+LASGS+D TV+LWD+ +S+K L T +   TN + S+   P  S
Sbjct: 1195 ILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDI-SSSKCLHTFQ-GHTNWVNSVAFNPDGS 1297          

HSP 10 Score: 80.4925 bits (197), Expect = 5.613e-15
Identity = 34/76 (44.74%), Postives = 54/76 (71.05%), Query Frame = -2
Query:  297 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTT 524
            GH S + S+  S DG+ +ASG +D T+ +WD++SG+C+    GHTS V ++ +S    +LASGS+D TV+LWD+++
Sbjct:  904 GHNSWVNSVGFSQDGKMLASGSDDQTVRLWDISSGQCLKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISS 979          

HSP 11 Score: 78.5666 bits (192), Expect = 2.133e-14
Identity = 33/78 (42.31%), Postives = 55/78 (70.51%), Query Frame = -2
Query:  297 FIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTT 530
            F GH + + S+A +PDG  +ASG  D T+ +W+++S +C+    GHTS V ++ +S +G++LASGS D TV+LW +++
Sbjct: 1280 FQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISS 1357          

HSP 12 Score: 77.7962 bits (190), Expect = 3.639e-14
Identity = 41/120 (34.17%), Postives = 69/120 (57.50%), Query Frame = -2
Query:  150 ILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 509
            +L++A SPDG+  A+GD  G +  W+ A+G+ +    GH S V ++ +S +G +LASGS D TV+LWD+++                + LKT    ++ V S+ FS  +L+ A+G+  +T
Sbjct:  867 VLTVAFSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGKMLASGSDDQTVRLWDISSG---------------QCLKTFKGHTSRVRSVVFSPNSLMLASGSSDQT 971          

HSP 13 Score: 77.411 bits (189), Expect = 4.752e-14
Identity = 42/103 (40.78%), Postives = 63/103 (61.17%), Query Frame = -2
Query:  216 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKST 524
            GH S + S+  SPDG  +ASG +D  + +WD++SG C+  L G+TS V  L +S  G  LA+GS+D  V+LWD+ +S K L T +   TN + ++   P  +T
Sbjct: 1072 GHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDI-SSKKCLYTLQ-GHTNWVNAVAFSPDGAT 1172          

HSP 14 Score: 74.7146 bits (182), Expect = 3.080e-13
Identity = 33/77 (42.86%), Postives = 53/77 (68.83%), Query Frame = -2
Query:  294 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTS 524
            G+ S +  L  SP+G  +A+G  D  + +WD++S +C+  L GHT+ V  +A+S +G+ LASGS D TV+LWD+++S
Sbjct: 1114 GYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSS 1190          
BLAST of DT214506 vs. ExPASy Swiss-Prot
Match: PKWA_THECU (Probable serine/threonine-protein kinase pkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.887e-16
Identity = 38/79 (48.10%), Postives = 54/79 (68.35%), Query Frame = -2
Query:  297 IFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTT 533
            +F GH   +L +A SPDG  +ASG  DGT  +W++A+G     L GHT  V+ +A+S +GS++ASGS D T++LWDV T
Sbjct:  538 VFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVAT 616          

HSP 2 Score: 75.8702 bits (185), Expect = 1.383e-13
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = -2
Query:  288 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTK 524
            GH   + ++A SPDG  +ASG +D T+ +WD+A+        GHT  V  +A+S +GS++ASGS D T +LW+V T T+
Sbjct:  499 GHTDWVRAVAFSPDGALLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTE 577          

HSP 3 Score: 72.7886 bits (177), Expect = 1.170e-12
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = -2
Query:  297 FIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTT 530
            F GH   + ++A SPDG  +ASG +D TI +WD+A+    T L GHT  V ++A+  EG+ LAS S D T+++W + T
Sbjct:  664 FEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEEHTTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPIAT 741          

HSP 4 Score: 71.633 bits (174), Expect = 2.608e-12
Identity = 43/116 (37.07%), Postives = 62/116 (53.45%), Query Frame = -2
Query:  162 ILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGA 509
            ++SLA SPDG  +  G  D T+ +WD+ASG  +    GHT  V  +A+S +G+LLASGS D T++LWDV         EE +         TL   + PV+S+ F       A+ +
Sbjct:  630 VVSLAFSPDGSMLVHGS-DSTVHLWDVASGEALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQ------EEHT---------TLEGHTEPVHSVAFHPEGTTLASAS 729          

HSP 5 Score: 69.3218 bits (168), Expect = 1.294e-11
Identity = 44/125 (35.20%), Postives = 64/125 (51.20%), Query Frame = -2
Query:  150 GHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKT 524
            GH   + ++A SPDG  +ASG  DGTI +WD+A+G+    L      V +LA+S +GS+L  GS D TV LWDV +                 +L T    +  V ++ FS    L A+G+  +T
Sbjct:  583 GHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAFSPDGSMLVHGS-DSTVHLWDVASG---------------EALHTFEGHTDWVRAVAFSPDGALLASGSDDRT 691          

HSP 6 Score: 68.9366 bits (167), Expect = 1.690e-11
Identity = 47/146 (32.19%), Postives = 73/146 (50.00%), Query Frame = -2
Query:  150 LSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYSCEGSLLASGSADCTVKLWDVTTSTK---------------------VLKTEEKSGTNRLRSLKT------LPTKSTPVYSLQFSRRNLLFAAGALSKT 506
            +++A SP G  +A G  D  I +WD+ASG  +  L GHT  V  +A+S +G+LLASGS D TV+LWDV  + +                     ++ +  + GT RL ++ T      L   +  VY++ FS    + A+G+   T
Sbjct:  463 VAVAFSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSPDGALLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGT 608          
The following BLAST results are available for this feature:
BLAST of DT214506 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
TAF5_MOUSE5.984e-2545.26Transcription initiation factor TFIID subunit 5 OS... [more]
TAF5_HUMAN7.815e-2545.26Transcription initiation factor TFIID subunit 5 OS... [more]
TAF5_DROME5.796e-2037.88Transcription initiation factor TFIID subunit 5 OS... [more]
TAF5_SCHPO9.886e-2035.21Transcription initiation factor TFIID subunit 5 OS... [more]
TAF5_YEAST1.291e-1934.21Transcription initiation factor TFIID subunit 5 OS... [more]
TAF5L_MOUSE4.153e-1838.40TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
HETE1_PODAN2.061e-1747.73Vegetative incompatibility protein HET-E-1 OS=Podo... [more]
TAF5L_HUMAN4.592e-1738.40TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
YY46_ANASP5.998e-1746.84Uncharacterized WD repeat-containing protein alr34... [more]
PKWA_THECU3.887e-1648.10Probable serine/threonine-protein kinase pkwA OS=T... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_16C03_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-16C03-F6-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214506 ID=DT214506|Name=DT214506|organism=Citrus sinensis|type=EST|length=540bp
TTTCTCGTTTCTTAATACGTGTTACAATATAGAACACAGAAAGTTATCAA
GCCCAATCGTTGACAAAGGATTCTGATTTTACATCCAAGACTTTGCCTGC
ACTGCTGTTGTTGAACTCGCCCATCCCGCTCAGCATAAATCTTCTATGAA
GTTTTTGAGAGAGCCCCCGCAGCAAATAGGAGATTTCTTCGAGAAAACTG
TAAAGAATAGACTGGCGTCGACTTGGTTGGCAGAGTTTTCAACGATCTCA
GTCTGTTTGTTCCACTCTTCTCTTCGGTTTTCAGCACCTTCGTGCTAGTA
GTGACATCCCATAATTTTACGGTGCAATCAGCAGATCCAGATGCGAGAAG
CGAACCTTCACAACTGTAGGCTAGTGTCCACACGCATGAGGTGTGACCCA
TCAAAGGGGTGACACAACGACCACTAGCAAGATCCCACATCATGATCGTG
CCATCTTCATCACCAGATGCCATGTACCGACCATCGGGTGACATTGCTAA
TGACAAAATCATACTCCTATGTCCAATAAAAATCCGGACA
back to top