DT214505

Overview
NameDT214505
Unique NameDT214505
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length814
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD2_MACFA (YTH domain family protein 2 OS=Macaca fascicularis GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.255e-32
Identity = 64/121 (52.89%), Postives = 82/121 (67.77%), Query Frame = -2
Query:  394 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKERSFHGKKSSK 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F V+W  +KDVPN+ LRHI LENNENKPVT+SRDTQE+ L++  ++LKI  SY   TS+ DDF+ YE ++      K  +
Sbjct:  454 PVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKER 574          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD2_HUMAN (YTH domain family protein 2 OS=Homo sapiens GN=YTHDF2 PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 2.255e-32
Identity = 64/121 (52.89%), Postives = 82/121 (67.77%), Query Frame = -2
Query:  394 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKERSFHGKKSSK 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F V+W  +KDVPN+ LRHI LENNENKPVT+SRDTQE+ L++  ++LKI  SY   TS+ DDF+ YE ++      K  +
Sbjct:  454 PVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKER 574          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD2_BOVIN (YTH domain family protein 2 OS=Bos taurus GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.255e-32
Identity = 64/121 (52.89%), Postives = 82/121 (67.77%), Query Frame = -2
Query:  394 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKERSFHGKKSSK 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F V+W  +KDVPN+ LRHI LENNENKPVT+SRDTQE+ L++  ++LKI  SY   TS+ DDF+ YE ++      K  +
Sbjct:  455 PVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKER 575          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD1_MOUSE (YTH domain family protein 1 OS=Mus musculus GN=Ythdf1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.119e-31
Identity = 62/111 (55.86%), Postives = 78/111 (70.27%), Query Frame = -2
Query:  424 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKE 756
            P++L FSVNGSG F G+AEM   VD+      W  DKW G F VKW  +KDVPN  LRHI LENN+NKPVT+SRDTQE+ L++  ++LKI  SY   TS+ DDF+ YE ++
Sbjct:  433 PVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 543          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD1_HUMAN (YTH domain family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.553e-31
Identity = 61/111 (54.95%), Postives = 77/111 (69.37%), Query Frame = -2
Query:  424 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKE 756
            P++L FSVNGSG F G+AEM   VD+      W  DKW G F V+W  +KDVPN  LRHI LENN+NKPVT+SRDTQE+ L++  ++LKI  SY   TS+ DDF  YE ++
Sbjct:  433 PVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQ 543          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD3_PONAB (YTH domain family protein 3 OS=Pongo abelii GN=YTHDF3 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.237e-30
Identity = 61/111 (54.95%), Postives = 78/111 (70.27%), Query Frame = -2
Query:  424 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKE 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F VKW  +KDVPN  LRHI LENN+NKPVT+SRDTQE+ L++  ++LKI  ++   TS+ DDF  YE ++
Sbjct:  460 PLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD3_MOUSE (YTH domain family protein 3 OS=Mus musculus GN=Ythdf3 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.237e-30
Identity = 61/111 (54.95%), Postives = 78/111 (70.27%), Query Frame = -2
Query:  424 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKE 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F VKW  +KDVPN  LRHI LENN+NKPVT+SRDTQE+ L++  ++LKI  ++   TS+ DDF  YE ++
Sbjct:  460 PLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YTHD3_HUMAN (YTH domain family protein 3 OS=Homo sapiens GN=YTHDF3 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.237e-30
Identity = 61/111 (54.95%), Postives = 78/111 (70.27%), Query Frame = -2
Query:  424 PIFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLDKWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKTSLLDDFNFYENKE 756
            P++L FSVNGSG F G+AEM   VD+N     W  DKW G F VKW  +KDVPN  LRHI LENN+NKPVT+SRDTQE+ L++  ++LKI  ++   TS+ DDF  YE ++
Sbjct:  460 PLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 570          
BLAST of DT214505 vs. ExPASy Swiss-Prot
Match: YD374_YEAST (YTH domain-containing protein YDR374C OS=Saccharomyces cerevisiae GN=YDR374C PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.017e-16
Identity = 41/104 (39.42%), Postives = 67/104 (64.42%), Query Frame = -2
Query:  448 IFLFFSVNGSGQFVGLAEMMGKVDFNKDMDFWQLD-KWNGFFPVKWHVIKDVPNTLLRHITLENNENKPVTHSRDTQEIGLKQGLEMLKIFKSYSAKT-SLLDD 753
            +FLFFS+N SG+F G+AEM+  +  + D   W+ + K+   F V+W +++D+ N  L+   + +NE KP+THSRDTQEI    G+ ++ +FK+  +   S LD+
Sbjct:  200 VFLFFSINTSGRFCGVAEMVSDLKMDLDTSIWEDEQKYGKAFKVRWVIVRDINNRSLKRFLIPSNEMKPITHSRDTQEIPYSIGISIINLFKTQDSDIFSFLDE 303          
The following BLAST results are available for this feature:
BLAST of DT214505 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
YTHD2_MACFA2.255e-3252.89YTH domain family protein 2 OS=Macaca fascicularis... [more]
YTHD2_HUMAN2.255e-3252.89YTH domain family protein 2 OS=Homo sapiens GN=YTH... [more]
YTHD2_BOVIN2.255e-3252.89YTH domain family protein 2 OS=Bos taurus GN=YTHDF... [more]
YTHD1_MOUSE1.119e-3155.86YTH domain family protein 1 OS=Mus musculus GN=Yth... [more]
YTHD1_HUMAN5.553e-3154.95YTH domain family protein 1 OS=Homo sapiens GN=YTH... [more]
YTHD3_PONAB1.237e-3054.95YTH domain family protein 3 OS=Pongo abelii GN=YTH... [more]
YTHD3_MOUSE1.237e-3054.95YTH domain family protein 3 OS=Mus musculus GN=Yth... [more]
YTHD3_HUMAN1.237e-3054.95YTH domain family protein 3 OS=Homo sapiens GN=YTH... [more]
YD374_YEAST1.017e-1639.42YTH domain-containing protein YDR374C OS=Saccharom... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_14H03_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-14H03-O6-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214505 ID=DT214505|Name=DT214505|organism=Citrus sinensis|type=EST|length=814bp
TCAATGTGTTAACTAGCAAAATAAATTAAACCAACCCAAAGGAGACCAAA
GGTCTCTACAAGCCAAATTACCACAAACAAGAAAAGGCAGCAAAGAGAAA
GAAAAAAAAAAAAAAACCACAGCTGGAAGAAGAAGCGAGTACAATACAAA
AGAAAAACTAGACCTACTGTTAATTTAGACCTCGAAAAAAAGCTAAGGTG
CAATGACCGAAGGAATTGCCTTCTCTACTGGATTCTTTACAGCTTCGCTC
TTCTTCTGGGTGCACGGCTTGAGGGAGAGATTTTTTGTAAGATTGATGAT
AGATATTGAGTCCTCATCAAATTCCTTCTCGGCAGATTTTATTTGCTTTG
TGAAATCATCATCATTAAATATATCCATTTGCAGAGTGGCCGGCTTACTG
CTCTTCTTGCCATGGAAAGACCTCTCTTTATTTTCATAGAAGTTAAAATC
ATCTAACAATGATGTTTTTGCTGAGTAACTTTTAAAGATCTTCAGCATTT
CTAAGCCTTGCTTTAACCCAATCTCTTGGGTGTCCCTGCTATGAGTGACA
GGCTTATTTTCATTATTTTCAAGGGTAATATGCCGCAACAGAGTGTTAGG
GACGTCTTTTATGACATGCCACTTAACAGGAAAGAACCCATTCCACTTGT
CAAGTTGCCAGAAGTCCATGTCTTTGTTGAAGTCCACCTTACCCATCATC
TCAGCTAGGCCGACAAATTGTCCACTTCCATTGACCGAAAAGAAGAGGAA
GATTGGACATCTTGTGCCAGTCTCATCTTGCCTTTGCTTCTGCCTCATTG
AAAGTTGCATCTAG
back to top