DT214504

Overview
NameDT214504
Unique NameDT214504
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length826
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-4cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12192 contig Csv1_Contig12192:190..1015. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_SPIOL (Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.115e-110
Identity = 199/231 (86.15%), Postives = 216/231 (93.51%), Query Frame = -2
Query:  133 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMPSGKVKYQVCSPEALSKLLVKHGVTQPAAETS 825
            QVEYAMEAIGNAGSAIGIL+KDGVVL+GEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYT++YQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWK           QS+LKQDYKDD++RE+AV+LALK LSKTMDSTSLTS+KLELAEV+L+PSGKVKYQV SPE+L++LL + G+TQPAAETS
Sbjct:   20 QVEYAMEAIGNAGSAIGILAKDGVVLIGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTFSYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKATAIGANNQAAQSMLKQDYKDDVTREDAVKLALKALSKTMDSTSLTSEKLELAEVYLLPSGKVKYQVHSPESLNRLLTESGLTQPAAETS 250          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_ARATH (Proteasome subunit alpha type-4 OS=Arabidopsis thaliana GN=PAC1 PE=1 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 2.338e-109
Identity = 201/231 (87.01%), Postives = 212/231 (91.77%), Query Frame = -2
Query:  133 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMPSGKVKYQVCSPEALSKLLVKHGVTQPAAETS 825
            QVEYAMEAIGNAGSAIGILSKDGVVL+GEKKVTSKLLQTSTS EKMYKIDDHVACAVAGIMSDANILINTARVQAQRYT+ YQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDK++GFQLYMSDPSGNYGGWK           QSILKQDYKDD +REEAV+LALKVL+KTMDSTSLTS+KLELAEV+L PS  VKY V SPE+L+KLLVKHGVTQPAAETS
Sbjct:   20 QVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDDATREEAVELALKVLTKTMDSTSLTSEKLELAEVYLTPSKTVKYHVHSPESLTKLLVKHGVTQPAAETS 250          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_PETHY (Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 7.040e-106
Identity = 196/231 (84.85%), Postives = 210/231 (90.91%), Query Frame = -2
Query:  133 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMPSGKVKYQVCSPEALSKLLVKHGVTQPAAETS 825
            QVEYAMEAIGNAGSAIGI SKDGVVLVGEKKVTSKLLQTSTS+EKMYKIDDHVACAVAGIMSDANILINTARVQAQRYT++YQEPMPVEQLVQSLCDTKQGYTQ+GGL PFGVSFLFAGWDKN+GFQL+MSDPSGNY GWK           QS+LKQDYKDDI+REEAVQLALKVLSKTMDSTSLTS+KLELAEVFL  +GKVKYQ CSPE L+ +LVK G+TQP+AE S
Sbjct:   20 QVEYAMEAIGNAGSAIGISSKDGVVLVGEKKVTSKLLQTSTSSEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTFSYQEPMPVEQLVQSLCDTKQGYTQYGGLPPFGVSFLFAGWDKNFGFQLFMSDPSGNYAGWKAAAIGANNQAAQSMLKQDYKDDITREEAVQLALKVLSKTMDSTSLTSEKLELAEVFL-SNGKVKYQACSPEKLNSMLVKSGLTQPSAEES 249          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4B_ORYSJ (Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.887e-99
Identity = 181/230 (78.70%), Postives = 203/230 (88.26%), Query Frame = -2
Query:  139 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMP-SGKVKYQVCSPEALSKLLVKHGVTQPAAE 825
            QVEYAMEAIGNAGSA+G+L+ DGVVLVGEKKVTSKLLQTS S EKMYKID H+ACAVAGIMSDANIL+NTAR+ AQRY  +YQEP+PVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDK++GFQLYMSDPSGNY GWK           QS+LKQDY+D ++REEAV LALKVLSKTMDSTSLT++KLELAEVFL P +G+V+YQVCSPEA+ KLL K G++QPA E
Sbjct:   20 QVEYAMEAIGNAGSALGVLAADGVVLVGEKKVTSKLLQTSRSAEKMYKIDSHLACAVAGIMSDANILLNTARLHAQRYALSYQEPIPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYSGWKAAAVGANSQAAQSMLKQDYRDGLTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGTGEVQYQVCSPEAMGKLLAKAGLSQPAPE 249          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4B_ORYSI (Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.887e-99
Identity = 181/230 (78.70%), Postives = 203/230 (88.26%), Query Frame = -2
Query:  139 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMP-SGKVKYQVCSPEALSKLLVKHGVTQPAAE 825
            QVEYAMEAIGNAGSA+G+L+ DGVVLVGEKKVTSKLLQTS S EKMYKID H+ACAVAGIMSDANIL+NTAR+ AQRY  +YQEP+PVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDK++GFQLYMSDPSGNY GWK           QS+LKQDY+D ++REEAV LALKVLSKTMDSTSLT++KLELAEVFL P +G+V+YQVCSPEA+ KLL K G++QPA E
Sbjct:   20 QVEYAMEAIGNAGSALGVLAADGVVLVGEKKVTSKLLQTSRSAEKMYKIDSHLACAVAGIMSDANILLNTARLHAQRYALSYQEPIPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYSGWKAAAVGANSQAAQSMLKQDYRDGLTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGTGEVQYQVCSPEAMGKLLAKAGLSQPAPE 249          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4A_ORYSJ (Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 6.382e-99
Identity = 181/230 (78.70%), Postives = 203/230 (88.26%), Query Frame = -2
Query:  139 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMP-SGKVKYQVCSPEALSKLLVKHGVTQPAAE 825
            QVEYAMEAIGNAGSA+G+L+ DGVVLVGEKKVTSKLLQTS S EKMYKID H+ACAVAGIMSDANIL+NTAR+ AQRY  +YQEP+PVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDK++GFQLYMSDPSGNY GWK           QS+LKQDY+D ++REEAV LALKVLSKTMDSTSLT++KLELAEVFL P +G+V+YQVCSPEA+ KLL K G++QPA E
Sbjct:   20 QVEYAMEAIGNAGSALGVLAADGVVLVGEKKVTSKLLQTSRSAEKMYKIDSHLACAVAGIMSDANILLNTARLHAQRYALSYQEPIPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYSGWKAAAVGANSQAAQSMLKQDYRDGMTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGTGEVQYQVCSPEAMGKLLAKAGLSQPAPE 249          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4A_ORYSI (Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 6.382e-99
Identity = 181/230 (78.70%), Postives = 203/230 (88.26%), Query Frame = -2
Query:  139 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMP-SGKVKYQVCSPEALSKLLVKHGVTQPAAE 825
            QVEYAMEAIGNAGSA+G+L+ DGVVLVGEKKVTSKLLQTS S EKMYKID H+ACAVAGIMSDANIL+NTAR+ AQRY  +YQEP+PVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDK++GFQLYMSDPSGNY GWK           QS+LKQDY+D ++REEAV LALKVLSKTMDSTSLT++KLELAEVFL P +G+V+YQVCSPEA+ KLL K G++QPA E
Sbjct:   20 QVEYAMEAIGNAGSALGVLAADGVVLVGEKKVTSKLLQTSRSAEKMYKIDSHLACAVAGIMSDANILLNTARLHAQRYALSYQEPIPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYSGWKAAAVGANSQAAQSMLKQDYRDGMTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGTGEVQYQVCSPEAMGKLLAKAGLSQPAPE 249          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_DICDI (Proteasome subunit alpha type-4 OS=Dictyostelium discoideum GN=psmA4 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 6.225e-70
Identity = 135/227 (59.47%), Postives = 170/227 (74.89%), Query Frame = -2
Query:  151 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTS-TEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWK-XXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMPSGKVKYQVCSPEALSKLLVKHGVTQ 825
            QVEYAM AI +AG+ +GIL+KDG+VL  EKK T+KLL +STS +EKM+KID+HV CAVAGI SDANILIN AR+ +QR+ Y YQEPMPVEQLV  +CDTKQGYTQ+GGLRPFGVSFL+AGWD++YGFQLY SDPSGN+ GWK            QS+L+ +YK DIS +EA+QLALKVL+KTMD +++ S+KLE +  F      V Y + +   L   + +  + Q
Sbjct:   20 QVEYAMTAIRHAGATVGILAKDGIVLAAEKKTTAKLLDSSTSISEKMFKIDEHVVCAVAGITSDANILINYARLSSQRFFYQYQEPMPVEQLVSQICDTKQGYTQYGGLRPFGVSFLYAGWDRHYGFQLYQSDPSGNFAGWKATSIGGENSQVAQSVLRSNYKPDISLKEALQLALKVLTKTMDRSNINSEKLEFS-YFTKQGDNVVYHIFTAAELDAFIKETDLEQ 245          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_YEAST (Proteasome component Y13 OS=Saccharomyces cerevisiae GN=PRE9 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 6.029e-65
Identity = 123/226 (54.42%), Postives = 166/226 (73.45%), Query Frame = -2
Query:  151 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKDDISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFL-MPSGKVKYQVCSPEALSKLLVKHGVTQ 825
            QVEYA+E+I +AG+AIGI++ DG+VL  E+KVTS LL+  TSTEK+YK++D +A AVAG+ +DA ILINTAR+ AQ Y   Y E +PVE LV+ L D KQGYTQ GGLRPFGVSF++AG+D  YG+QLY S+PSGNY GWK           Q++L+ DYKDD+  ++A++LALK LSKT DS++LT D+LE A +      G+V  ++  P+ +  +LVK G+T+
Sbjct:   21 QVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITK 246          
BLAST of DT214504 vs. ExPASy Swiss-Prot
Match: PSA4_MOUSE (Proteasome subunit alpha type-4 OS=Mus musculus GN=Psma4 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.370e-63
Identity = 122/230 (53.04%), Postives = 163/230 (70.87%), Query Frame = -2
Query:  139 QVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNYGFQLYMSDPSGNYGGWKXXXXXXXXXXXQSILKQDYKD-DISREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLMPSGKVKYQVCSPEALSKLLVKHGVTQPAAE 825
            QVEYAMEAIG+AG+ +GIL+ DGV+L  E++   KLL     +EK+YK+++ +AC+VAGI SDAN+L N  R+ AQRY   YQEP+P EQLV +LCD KQ YTQFGG RPFGVS L+ GWDK+YGFQLY SDPSGNYGGWK            S+LKQDYK+ +++ + A+ LA+KVL+KTMD + L+++K+E+A      SGK   +V   + + +L+ KH   +  AE
Sbjct:   20 QVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIA-TLTRESGKTVIRVLKQKEVEQLIKKHEEEEAKAE 248          
The following BLAST results are available for this feature:
BLAST of DT214504 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
PSA4_SPIOL2.115e-11086.15Proteasome subunit alpha type-4 OS=Spinacia olerac... [more]
PSA4_ARATH2.338e-10987.01Proteasome subunit alpha type-4 OS=Arabidopsis tha... [more]
PSA4_PETHY7.040e-10684.85Proteasome subunit alpha type-4 OS=Petunia hybrida... [more]
PSA4B_ORYSJ4.887e-9978.70Proteasome subunit alpha type-4-2 OS=Oryza sativa ... [more]
PSA4B_ORYSI4.887e-9978.70Proteasome subunit alpha type-4-2 OS=Oryza sativa ... [more]
PSA4A_ORYSJ6.382e-9978.70Proteasome subunit alpha type-4-1 OS=Oryza sativa ... [more]
PSA4A_ORYSI6.382e-9978.70Proteasome subunit alpha type-4-1 OS=Oryza sativa ... [more]
PSA4_DICDI6.225e-7059.47Proteasome subunit alpha type-4 OS=Dictyostelium d... [more]
PSA4_YEAST6.029e-6554.42Proteasome component Y13 OS=Saccharomyces cerevisi... [more]
PSA4_MOUSE7.370e-6353.04Proteasome subunit alpha type-4 OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS08_13F08_b2 Parent Washington Navel Orange Callus cDNA Library UCRCS08-4 Citrus sinensis cDNA clone UCRCS08-13F08-K15-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214504 ID=DT214504|Name=DT214504|organism=Citrus sinensis|type=EST|length=826bp
AATACAAGCTTCTGATCTCACATCAAACACATCGATCTGCAGTTCTTTGG
GCAAACTCACTGGAGTAATACAAGTACTGTCCAAATTGCTTTGAAATTTA
GTTATAATGAAAGCATGGAAGATCTTCATTCAAGAAGTCTCAGCAGCAGG
TTGGGTTACTCCATGCTTCACCAACAACTTGCTCAGAGCTTCGGGTGAGC
AAACTTGGTACTTCACTTTGCCAGAAGGCATCAGGAAAACCTCAGCTAAT
TCAAGCTTATCAGAAGTAAGACTGGTGCTGTCCATGGTTTTGCTGAGCAC
CTTCAGTGCTAGTTGAACTGCTTCTTCCCTTGAAATATCATCCTTGTAAT
CTTGTTTGAGGATTGATTGTGCAGCCTGGTTATTTGCACCAATAGCAGCA
GCTTTCCAACCACCATAGTTTCCACTAGGATCACTCATGTAAAGTTGGAA
GCCATAATTTTTGTCCCACCCTGCAAAAAGAAATGAAACACCAAAGGGGC
GGAGACCGCCAAACTGGGTGTAACCTTGCTTTGTATCACAAAGAGATTGA
ACAAGCTGCTCAACAGGCATTGGCTCTTGGTAGGCATATGTGTAACGTTG
GGCTTGGACCCTGGCAGTGTTGATTAGGATGTTGGCATCAGACATTATTC
CAGCTACGGCACAAGCAACATGATCATCAATCTTGTACATCTTCTCAGTG
GAAGTTGAGGTTTGCAGGAGCTTCGAAGTAACCTTCTTTTCACCAACCAA
GACAACCCCATCTTTCGATAATATTCCAATTGCACTACCAGCATTTCCAA
TGGCCTCCATTGCATACTCAACTTGA
back to top