CX293892

Overview
NameCX293892
Unique NameCX293892
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length508
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14178 contig Ccv1_Contig14178:38..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: TLP_ACTDE (Thaumatin-like protein OS=Actinidia deliciosa GN=tlp PE=1 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 6.115e-58
Identity = 96/142 (67.61%), Postives = 113/142 (79.58%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVPGGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRVIKCTANILGECPNELKVPGGCNGPC 505
            F+I NNCP TVWAAAVPGGG++LD+GQ W I    GTK AR+W RT C FD +G+GKC+TGDCNGLL+CQ +G  PNTLAEYAL QFN++DF D+S +DGFNV MEFS  S  C R IKCTA+I G+CPNEL+ PGGCN PC
Sbjct:   27 FNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPGAGTKGARVWPRTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTSGGCTRGIKCTADINGQCPNELRAPGGCNNPC 168          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OSL3_ARATH (Osmotin-like protein OSM34 OS=Arabidopsis thaliana GN=OSM34 PE=2 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 2.659e-53
Identity = 89/142 (62.68%), Postives = 112/142 (78.87%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVPGGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRVIKCTANILGECPNELKVPGGCNGPC 505
            F+I N C  TVWAAA PGGGR+LD GQ+W +    GTK ARIW RT C FD+SG+G+C+TGDC+G L+C G+G  PNTLAEYAL QFN++DF D+S +DGFN+PMEFS  S +C+R++ CTA+I G+CPN L+ PGGCN PC
Sbjct:   25 FEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRIL-CTADINGQCPNVLRAPGGCNNPC 165          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: TPM1_SOLLC (Osmotin-like protein TPM-1 (Fragment) OS=Solanum lycopersicum GN=TPM-1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 2.939e-52
Identity = 90/145 (62.07%), Postives = 110/145 (75.86%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNR--VIKCTANILGECPNELKVPGGCNGPC 505
            F++ NNCP TVWAA+ P GGGR+LD+GQTW I A  GTK ARIW RT C FD  G+G C+TGDC G+L+C G+G  PNTLAEYAL QF+++DF D+S +DGFN+PM F+  +PS  +   I CTANI GECP  L+VPGGCN PC
Sbjct:   16 FEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDGDGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIHCTANINGECPGSLRVPGGCNNPC 160          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: P21_SOYBN (Protein P21 OS=Glycine max PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.839e-52
Identity = 89/144 (61.81%), Postives = 110/144 (76.39%), Query Frame = 2
Query:   77 KFDITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRVIKCTANILGECPNELKVPGGCNGPC 505
            +F+ITN C  TVWAA+VP GGG QL+ GQ+W++    GTK AR+WART C FD SG+G C+TGDC G+L+C+ YGA PNTLAEY L  FN++DF D+S +DGFNVPM+FS  S  C R I CTA+I G+CP+ELK  GGCN PC
Sbjct:    2 RFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSGRGGCQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNGCTRGISCTADINGQCPSELKTQGGCNNPC 145          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: PRR1_TOBAC (Pathogenesis-related protein R major form OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 6.548e-52
Identity = 92/142 (64.79%), Postives = 107/142 (75.35%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVPGGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRVIKCTANILGECPNELKVPGGCNGPC 505
            FDI N C  TVWAAA PGGGR+LD GQ+W+I   PGT  ARIW RT C FD SG+G CETGDCNG+LECQGYG APNTLAE+AL Q N  DF+D+S +DGFN+PMEFS  +  C R ++CTA I  +CP +LK  GGCN PC
Sbjct:   28 FDIVNKCTYTVWAAASPGGGRRLDSGQSWSINVNPGTVQARIWGRTNCNFDGSGRGNCETGDCNGMLECQGYGKAPNTLAEFALNQPN-QDFVDISLVDGFNIPMEFSPTNGGC-RNLRCTAPINEQCPAQLKTQGGCNNPC 167          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OLPA_TOBAC (Osmotin-like protein OS=Nicotiana tabacum GN=OLPA PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 8.552e-52
Identity = 90/145 (62.07%), Postives = 110/145 (75.86%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRV--IKCTANILGECPNELKVPGGCNGPC 505
            F++ NNCP TVWAAA P GGGR+L++GQ+W   A PGTK ARIW RT C FD +G+G C+TGDC G+LEC+G+G  PNTLAEYAL QF+++DF D+S IDGFN+PM F    P   +   I+CTANI GECP  L+VPGGCN PC
Sbjct:   25 FEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVPGGCNNPC 169          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OSMO_TOBAC (Osmotin OS=Nicotiana tabacum GN=AP24 PE=1 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 1.117e-51
Identity = 89/144 (61.81%), Postives = 111/144 (77.08%), Query Frame = 2
Query:   83 DITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNR--VIKCTANILGECPNELKVPGGCNGPC 505
            ++ NNCP TVWAA+ P GGGR+LD+GQTW I A  GTK AR+W RT C F+A+G+G C+TGDC G+L+C G+G  PNTLAEYAL QF+ +DF D+S +DGFN+PM F+  +PS  +   I CTANI GECP EL+VPGGCN PC
Sbjct:   25 EVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIHCTANINGECPRELRVPGGCNNPC 168          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OS13_SOLCO (Osmotin-like protein OSML13 OS=Solanum commersonii PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.117e-51
Identity = 89/144 (61.81%), Postives = 110/144 (76.39%), Query Frame = 2
Query:   83 DITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNR--VIKCTANILGECPNELKVPGGCNGPC 505
            ++ NNCP TVWAA+ P GGGR+LD+GQTW I A  GTK ARIW RT C FD +G+G C+TGDC G+L+C G+G  PNTLAEYAL QF+++DF D+S +DGFN+PM F+  +PS  +   I CTANI GECP  L+VPGGCN PC
Sbjct:   25 EVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTNPSGGKCHAIHCTANINGECPGSLRVPGGCNNPC 168          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OS81_SOLCO (Osmotin-like protein OSML81 OS=Solanum commersonii PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.459e-51
Identity = 90/144 (62.50%), Postives = 110/144 (76.39%), Query Frame = 2
Query:   83 DITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNR--VIKCTANILGECPNELKVPGGCNGPC 505
            ++ NNCP TVWAA+ P GGGR+L+KGQTW I A  GTK ARIW RT C F+A+G+G C+TGDC G+L+C G+G  PNTLAEYAL QF+++DF D+S +DGFN+PM F+   PS  +   I CTANI GECP  LKVPGGCN PC
Sbjct:   25 EVRNNCPYTVWAASTPIGGGRRLNKGQTWVINAPRGTKMARIWGRTGCNFNAAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRALKVPGGCNNPC 168          
BLAST of CX293892 vs. ExPASy Swiss-Prot
Match: OS35_SOLCO (Osmotin-like protein OSML15 OS=Solanum commersonii PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.488e-51
Identity = 89/145 (61.38%), Postives = 110/145 (75.86%), Query Frame = 2
Query:   80 FDITNNCPDTVWAAAVP-GGGRQLDKGQTWTITAEPGTKAARIWARTKCQFDASGKGKCETGDCNGLLECQGYGAAPNTLAEYALKQFNDMDFIDMSNIDGFNVPMEFSSVSPSCNRV--IKCTANILGECPNELKVPGGCNGPC 505
            F++ NNCP TVWAAA P GGGR+L++GQ+W   A PGTK ARIW RT C FD +G+G C+TGDC G+LEC+G+G  PNTLAEYAL QF+++DF D+S IDGFN+PM F   +P   +   I+C ANI GECP  L+VPGGCN PC
Sbjct:   25 FEVHNNCPYTVWAAATPIGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECPGSLRVPGGCNNPC 169          
The following BLAST results are available for this feature:
BLAST of CX293892 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
TLP_ACTDE6.115e-5867.61Thaumatin-like protein OS=Actinidia deliciosa GN=t... [more]
OSL3_ARATH2.659e-5362.68Osmotin-like protein OSM34 OS=Arabidopsis thaliana... [more]
TPM1_SOLLC2.939e-5262.07Osmotin-like protein TPM-1 (Fragment) OS=Solanum l... [more]
P21_SOYBN3.839e-5261.81Protein P21 OS=Glycine max PE=1 SV=1[more]
PRR1_TOBAC6.548e-5264.79Pathogenesis-related protein R major form OS=Nicot... [more]
OLPA_TOBAC8.552e-5262.07Osmotin-like protein OS=Nicotiana tabacum GN=OLPA ... [more]
OSMO_TOBAC1.117e-5161.81Osmotin OS=Nicotiana tabacum GN=AP24 PE=1 SV=2[more]
OS13_SOLCO1.117e-5161.81Osmotin-like protein OSML13 OS=Solanum commersonii... [more]
OS81_SOLCO1.459e-5162.50Osmotin-like protein OSML81 OS=Solanum commersonii... [more]
OS35_SOLCO2.488e-5161.38Osmotin-like protein OSML15 OS=Solanum commersonii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05002B10SK FlavRip1 Citrus clementina cDNA clone C05002B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293892 ID=CX293892|Name=CX293892|organism=Citrus clementina|type=EST|length=508bp
AATGAAGTTCGTTAAAGCTCTTCCCATTTCTTCTGCTCTTCTTATTATCA
TTTCCATCACCCTGACTCATGCTGCCAAATTCGATATCACAAACAATTGC
CCCGACACCGTCTGGGCCGCCGCTGTGCCCGGAGGCGGCAGGCAACTCGA
CAAGGGTCAAACATGGACCATCACCGCCGAGCCAGGCACAAAAGCAGCCC
GCATTTGGGCTCGAACCAAATGCCAGTTTGATGCTTCCGGCAAAGGCAAA
TGCGAGACCGGTGACTGTAACGGACTCCTCGAGTGCCAAGGCTACGGTGC
AGCACCTAACACCTTGGCCGAGTACGCGTTGAAGCAATTCAATGACATGG
ATTTCATTGACATGTCCAACATTGACGGATTCAATGTTCCCATGGAATTT
AGCTCTGTCTCTCCCTCATGCAACCGCGTGATCAAGTGCACTGCTAACAT
TCTTGGCGAGTGCCCGAATGAATTGAAGGTTCCTGGAGGATGTAACGGGC
CGTGCCCC
back to top