CX293899

Overview
NameCX293899
Unique NameCX293899
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length497
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX293899 vs. ExPASy Swiss-Prot
Match: FACR2_ARATH (Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 2.473e-24
Identity = 59/117 (50.43%), Postives = 78/117 (66.67%), Query Frame = -3
Query:  166 VPVMKLFTSMEDFSAHLLDGAMQRSIIGSSNGEL---LAQKQYEILRR-----KEFANVYLPYGLYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDWKHYITNVHVPGLRRHVMK 492
            V +MKLF S++DFS HL   A +RS + S    +   + QK   I ++     K  A +Y PY  Y GRFD SNT  LM+ M+E+EK++FGFD+GSI+W  YITNVH+PGLRRHV+K
Sbjct:  497 VRLMKLFNSVDDFSDHLWRDAQERSGLMSGMSSVDSKMMQKLKFICKKSVEQAKHLATIYEPYTFYGGRFDNSNTQRLMENMSEDEKREFGFDVGSINWTDYITNVHIPGLRRHVLK 613          
BLAST of CX293899 vs. ExPASy Swiss-Prot
Match: FACR6_ARATH (Fatty acyl-CoA reductase 6, chloroplastic OS=Arabidopsis thaliana GN=FAR6 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.717e-17
Identity = 44/112 (39.29%), Postives = 69/112 (61.61%), Query Frame = -3
Query:  151 MKLFTSMEDFSAHLLDGAM-QRSIIGSSNGELLAQKQYEILRRKEFANVYLPYGLYAGRFDCSNTLGLMQIMNEEEKKKFGFDMGSIDWKHYITNVHVPGLRRHVMKEKRGE 483
            MK+ +S+E F++ L +  + Q  +I +  G L  + + ++      A  Y PY  +  RFD +NT  L+Q M+ EEKK FGFD+  IDW+HYI NVH+PGL++  + +K+ E
Sbjct:  437 MKIHSSLEGFTSALSNTIIKQERVIDNEGGGLSTKGKRKLNYFVSLAKTYEPYTFFQARFDNTNTTSLIQEMSMEEKKTFGFDIKGIDWEHYIVNVHLPGLKKEFLSKKKTE 548          
The following BLAST results are available for this feature:
BLAST of CX293899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
FACR2_ARATH2.473e-2450.43Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana... [more]
FACR6_ARATH1.717e-1739.29Fatty acyl-CoA reductase 6, chloroplastic OS=Arabi... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05002C07SK FlavRip1 Citrus clementina cDNA clone C05002C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293899 ID=CX293899|Name=CX293899|organism=Citrus clementina|type=EST|length=497bp
TAGTTTTATTTTTTAATGTGGCCCCCGTAAGTTTAACACTTTAGCAGTTT
AACCCAATAATTAAATGCATTTTTTAACCTTTACTCCTTAAAGTTTACTT
TTATCAAATTTTGGCCCCCCTGGAATTTTATTCCCAGCTCCCACCAATGT
CTCCCCTCTCTTTTCCTTCATGACATGCCTCCTTAAGCCTGGTACGTGAA
CATTTGTAATGTAATGCTTCCAATCAATGCTCCCCATGTCAAATCCAAAC
TTTTTCTTCTCTTCTTCATTCATGATCTGCATTAGCCCCAGTGTGTTGCT
GCAATCAAACCTTCCAGCATAAAGTCCGTATGGAAGGTATACATTAGCGA
ACTCCTTTCTGCGTAAAATTTCATATTGTTTCTGAGCCAGCAGCTCGCCA
TTTGAAGATCCAATAATGCTTCGCTGCATGGCACCATCCAAAAGGTGAGC
TGAAAAATCTTCCATGGAAGTGAAAAGCTTCATTACTGGAACACGGA
back to top