CX294973

Overview
NameCX294973
Unique NameCX294973
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1687 contig Ccv1_Contig1687:44..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294973 vs. ExPASy Swiss-Prot
Match: PP179_ARATH (Pentatricopeptide repeat-containing protein At2g32230, mitochondrial OS=Arabidopsis thaliana GN=At2g32230 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.777e-18
Identity = 55/143 (38.46%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  257 MLRGNFLTPSLIRTS-PFLTFLSKISLPLMHQSNCHTYRPLLCWHMHSFTKPITDIKQNRFSADLTTGLCTLAFSKKSTVNESSAPNTGTMSNKSKKKARRESPEGVLRHKLDMCSKRGDVFEALRLYDDARSNGITLSPHHY 682
            MLR    TPS  R   P    + K+    +H      + P   +H     K   D  +     + +  LCTL  +      +S+A  +  +S K+KKKA ++SPE +L+ KLDMCSK+GDV EALRLYD+AR NG+ LS +HY
Sbjct:    1 MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPR---FSPFRFYHTSLLVKGTRD--RRLILVERSRHLCTLPLA---AAKQSAASPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHY 135          
The following BLAST results are available for this feature:
BLAST of CX294973 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PP179_ARATH6.777e-1838.46Pentatricopeptide repeat-containing protein At2g32... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05065B12SK DroRLeaf1 Citrus clementina cDNA clone C05065B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294973 ID=CX294973|Name=CX294973|organism=Citrus clementina|type=EST|length=683bp
CCTAAACCCTATCTCTTTCCTGCTTTTGGCGGATTTAAAATTTCATTCTC
AATTTCTCAGTGCTCCATCAATTCTTCAGCAATGAAGATGCCTAGTTTCC
ATGAAATGATAGAACACTGTTCAATGTTCCATTACCGCAAAATGTGACAT
CAGGATATATGAAGCAACTCATTCTGCAAATGGTTTGCTCTGAATTACAA
CTTTGAATTTTCCTCATAAGAAAGCAACTGAGAGGGAGAATCAATAGTTG
AGGCAAATGCTGCGTGGAAACTTTCTCACTCCTTCACTCATCAGAACCTC
CCCTTTCTTGACATTCCTCTCCAAAATCTCATTGCCATTAATGCATCAAA
GTAATTGCCACACCTACCGTCCACTTCTTTGCTGGCATATGCACTCCTTC
ACTAAACCCATCACTGATATTAAGCAAAATCGCTTCTCTGCGGACTTAAC
AACTGGTTTATGCACCCTTGCTTTCTCTAAGAAATCAACTGTTAATGAAT
CCTCAGCCCCAAATACAGGCACTATGTCAAATAAATCAAAGAAGAAAGCA
CGCCGAGAATCTCCTGAGGGAGTGCTTAGACATAAGCTTGATATGTGTTC
CAAGCGTGGCGATGTTTTTGAAGCCCTACGCTTATATGATGATGCACGAA
GTAATGGCATCACGCTCAGCCCACACCACTATA
back to top