CX308528

Overview
NameCX308528
Unique NameCX308528
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length217
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig942 contig Ccv1_Contig942:507..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK40_ARATH (Probable WRKY transcription factor 40 OS=Arabidopsis thaliana GN=WRKY40 PE=1 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 4.196e-12
Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = -2
Query:   16 SCKKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLTNYCS 147
            S KKKVQR +ED+S LVATYEGEHNH +  S +  ++ L  + S
Sbjct:  178 SVKKKVQRSVEDQSVLVATYEGEHNHPMP-SQIDSNNGLNRHIS 220          

HSP 2 Score: 43.5134 bits (101), Expect = 4.196e-12
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:  132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215
            QKVT+DNPSPRAYF+C  A S C VKK+
Sbjct:  156 QKVTRDNPSPRAYFKCACAPS-CSVKKK 182          
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRKY6_ARATH (WRKY transcription factor 6 OS=Arabidopsis thaliana GN=WRKY6 PE=1 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 2.561e-11
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = -2
Query:   28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141
            +K+VQRC ED+S L+ TYEG HNH +  +++  +S+ T
Sbjct:  346 RKQVQRCAEDRSILITTYEGNHNHPLPPAAVAMASTTT 383          

HSP 2 Score: 42.3578 bits (98), Expect = 2.561e-11
Identity = 18/28 (64.29%), Postives = 23/28 (82.14%), Query Frame = -3
Query:  132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215
            QK+ K NP PRAY+RC MA +GCPV+K+
Sbjct:  322 QKMAKGNPCPRAYYRCTMA-TGCPVRKQ 348          
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1)

HSP 1 Score: 45.4394 bits (106), Expect = 5.604e-11
Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -2
Query:   28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141
            +K+VQRC ED+S L+ TYEG HNH +  ++   +S+ T
Sbjct:  331 RKQVQRCAEDRSILITTYEGNHNHPLPPAATAMASTTT 368          

HSP 2 Score: 41.9726 bits (97), Expect = 5.604e-11
Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = -3
Query:  132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215
            QK+ K NP PRAY+RC MA  GCPV+K+
Sbjct:  307 QKMAKGNPCPRAYYRCTMA-GGCPVRKQ 333          
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1)

HSP 1 Score: 45.4394 bits (106), Expect = 9.444e-11
Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = -2
Query:   28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141
            +K+VQRC ED++ L+ TYEG HNH +  +++  +S+ T
Sbjct:  326 RKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTT 363          

HSP 2 Score: 41.2022 bits (95), Expect = 9.444e-11
Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = -3
Query:  132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215
            QK+ K NP PRAY+RC MA  GCPV+K+
Sbjct:  302 QKMAKGNPCPRAYYRCTMA-VGCPVRKQ 328          
The following BLAST results are available for this feature:
BLAST of CX308528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
WRK40_ARATH4.196e-1254.55Probable WRKY transcription factor 40 OS=Arabidops... [more]
WRKY6_ARATH2.561e-1147.37WRKY transcription factor 6 OS=Arabidopsis thalian... [more]
WRK31_ARATH5.604e-1147.37Probable WRKY transcription factor 31 OS=Arabidops... [more]
WRK42_ARATH9.444e-1144.74Probable WRKY transcription factor 42 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21001A02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308528 ID=CX308528|Name=CX308528|organism=Citrus clementina|type=EST|length=217bp
AATTGAGCTTTTGGGTGAGCAATAATTTGTTAAAGAGGAGGATTGCCCAA
GTGAGCTACATTGAACATCATGGTTGTGTTCTCCTTCATAAGTTGCAACG
AGAAATGACTTGTCCTCCATGCATCTTTGAACCTTTTTTTTACAGGACAT
CCAGAAGAAGCCATTAAACATCTGAAATAAGCCCGAGGTGAGGGATTATC
TTTAGTAACCTTTTGGC
back to top