CX308528
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK40_ARATH (Probable WRKY transcription factor 40 OS=Arabidopsis thaliana GN=WRKY40 PE=1 SV=1) HSP 1 Score: 47.7506 bits (112), Expect = 4.196e-12 Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = -2 Query: 16 SCKKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLTNYCS 147 S KKKVQR +ED+S LVATYEGEHNH + S + ++ L + S Sbjct: 178 SVKKKVQRSVEDQSVLVATYEGEHNHPMP-SQIDSNNGLNRHIS 220 HSP 2 Score: 43.5134 bits (101), Expect = 4.196e-12 Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3 Query: 132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215 QKVT+DNPSPRAYF+C A S C VKK+ Sbjct: 156 QKVTRDNPSPRAYFKCACAPS-CSVKKK 182
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRKY6_ARATH (WRKY transcription factor 6 OS=Arabidopsis thaliana GN=WRKY6 PE=1 SV=1) HSP 1 Score: 46.2098 bits (108), Expect = 2.561e-11 Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = -2 Query: 28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141 +K+VQRC ED+S L+ TYEG HNH + +++ +S+ T Sbjct: 346 RKQVQRCAEDRSILITTYEGNHNHPLPPAAVAMASTTT 383 HSP 2 Score: 42.3578 bits (98), Expect = 2.561e-11 Identity = 18/28 (64.29%), Postives = 23/28 (82.14%), Query Frame = -3 Query: 132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215 QK+ K NP PRAY+RC MA +GCPV+K+ Sbjct: 322 QKMAKGNPCPRAYYRCTMA-TGCPVRKQ 348
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1) HSP 1 Score: 45.4394 bits (106), Expect = 5.604e-11 Identity = 18/38 (47.37%), Postives = 27/38 (71.05%), Query Frame = -2 Query: 28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141 +K+VQRC ED+S L+ TYEG HNH + ++ +S+ T Sbjct: 331 RKQVQRCAEDRSILITTYEGNHNHPLPPAATAMASTTT 368 HSP 2 Score: 41.9726 bits (97), Expect = 5.604e-11 Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = -3 Query: 132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215 QK+ K NP PRAY+RC MA GCPV+K+ Sbjct: 307 QKMAKGNPCPRAYYRCTMA-GGCPVRKQ 333
BLAST of CX308528 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1) HSP 1 Score: 45.4394 bits (106), Expect = 9.444e-11 Identity = 17/38 (44.74%), Postives = 28/38 (73.68%), Query Frame = -2 Query: 28 KKKVQRCMEDKSFLVATYEGEHNHDVQCSSLGQSSSLT 141 +K+VQRC ED++ L+ TYEG HNH + +++ +S+ T Sbjct: 326 RKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTT 363 HSP 2 Score: 41.2022 bits (95), Expect = 9.444e-11 Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = -3 Query: 132 QKVTKDNPSPRAYFRCLMASSGCPVKKR 215 QK+ K NP PRAY+RC MA GCPV+K+ Sbjct: 302 QKMAKGNPCPRAYYRCTMA-VGCPVRKQ 328 The following BLAST results are available for this feature:
BLAST of CX308528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308528 ID=CX308528; Name=CX308528; organism=Citrus clementina; type=EST; length=217bpback to top |