CX308533

Overview
NameCX308533
Unique NameCX308533
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length409
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308533 vs. ExPASy Swiss-Prot
Match: IF2B_MALDO (Eukaryotic translation initiation factor 2 subunit beta OS=Malus domestica PE=2 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 9.848e-19
Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 3
Query:    6 GCKSPDTILSKENRLFFLRCEKCGSGRSVAPIKAGFQARVGRRNAG 143
            GC+SPDTILSKENRLFFLRCEKCGSGRSVAP KAGF ARVGRRNAG
Sbjct:  225 GCQSPDTILSKENRLFFLRCEKCGSGRSVAPNKAGFMARVGRRNAG 270          
BLAST of CX308533 vs. ExPASy Swiss-Prot
Match: IF2B_WHEAT (Eukaryotic translation initiation factor 2 subunit beta OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.857e-17
Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 3
Query:    6 GCKSPDTILSKENRLFFLRCEKCGSGRSVAPIKAGFQARVGRRNAG 143
            GCKSPDTILSKENRLFFLRCE+CGS RSVAPIKAGF A+VGRR AG
Sbjct:  224 GCKSPDTILSKENRLFFLRCEQCGSSRSVAPIKAGFVAQVGRRKAG 269          
BLAST of CX308533 vs. ExPASy Swiss-Prot
Match: IF2B_ARATH (Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana GN=EMB1401 PE=2 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 7.803e-16
Identity = 39/43 (90.70%), Postives = 39/43 (90.70%), Query Frame = 3
Query:    6 GCKSPDTILSKENRLFFLRCEKCGSGRSVAPIKAGFQARVGRR 134
            GCKSPDTILSKENRLFFLRCEKCGS RSVAPIK GF ARV RR
Sbjct:  224 GCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKTGFVARVSRR 266          
BLAST of CX308533 vs. ExPASy Swiss-Prot
Match: IF2B_SCHPO (Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe GN=tif212 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.523e-11
Identity = 29/42 (69.05%), Postives = 36/42 (85.71%), Query Frame = 3
Query:    9 CKSPDTILSKENRLFFLRCEKCGSGRSVAPIKAGFQARVGRR 134
            CKSPDTIL+KENR+FF+ CE CGS RSV  IK G+QA++G+R
Sbjct:  276 CKSPDTILTKENRIFFMTCEACGSVRSVQAIKTGYQAQIGKR 317          
The following BLAST results are available for this feature:
BLAST of CX308533 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
IF2B_MALDO9.848e-1993.48Eukaryotic translation initiation factor 2 subunit... [more]
IF2B_WHEAT1.857e-1789.13Eukaryotic translation initiation factor 2 subunit... [more]
IF2B_ARATH7.803e-1690.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2B_SCHPO1.523e-1169.05Probable eukaryotic translation initiation factor ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21001A08Rv AbsLeaSub1 Citrus clementina cDNA clone C21001A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308533 ID=CX308533|Name=CX308533|organism=Citrus clementina|type=EST|length=409bp
GCGGGGGGTGCAAAAGTCCTGACACGATACTTTCAAAGGAAAACCGCCTC
TTCTTTCTCAGATGTGAGAAGTGTGGTTCTGGACGATCAGTTGCTCCTAT
CAAAGCTGGTTTCCAGGCACGTGTTGGTCGTAGAAATGCTGGAATGTGAT
CTTGTTGTCCTGCTTTTCTCCAGCATTTTGAAAAAAAAGCTGTTTGTTTT
CATTTTTACCTTATGCGTTTTACTACTATTTGGTTTTGACTAATTGTATT
TATCTAGCCGGGAAAATATTGATATGGATGAGCCTTTATAACTAGAATGA
TTGATTAATCCTTTTTACATATTTTCCTGCTGAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAAAAAAAAAAAAAAAAAAA
AAAAAAAAA
back to top