CX308548

Overview
NameCX308548
Unique NameCX308548
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length426
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX308548_ssr53 microsatellite CX308548_ssr53:53..70. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.086e-20
Identity = 46/53 (86.79%), Postives = 49/53 (92.45%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233
            MGS T LEVILAI+LPPVGVFLRY  GVEFWICLLLT+LGYIPGIIYA+YVLV
Sbjct:    1 MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVLV 53          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.086e-20
Identity = 46/53 (86.79%), Postives = 49/53 (92.45%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233
            MGS T LEVILAI+LPPVGVFLRY  GVEFWICLLLT+LGYIPGIIYA+YVLV
Sbjct:    1 MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVLV 53          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.031e-20
Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233
            M S TF+EVILAI+LPPVGVFLRYG  VEFWICLLLT+LGYIPGIIYA+YVLV
Sbjct:    1 MASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVLV 53          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.532e-19
Identity = 41/52 (78.85%), Postives = 50/52 (96.15%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            M + TF+++I+AILLPP+GVFLR+GCGVEFWICL+LT+LGYIPGIIYAIYVL
Sbjct:    1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVL 52          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.194e-17
Identity = 34/52 (65.38%), Postives = 48/52 (92.31%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            M + TF+E+ILAI+LPP+GVFL++GC VEFWICL+LT+ GY+PGI+YA+Y++
Sbjct:    1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYII 52          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.704e-16
Identity = 38/50 (76.00%), Postives = 47/50 (94.00%), Query Frame = 3
Query:   87 TFLEVILAILLPPVGVFLRYGC-GVEFWICLLLTVLGYIPGIIYAIYVLV 233
            TFLE++LAI+LPP+GVFLR+GC  +EF ICLLLT+LGY+PGIIYA+YVLV
Sbjct:    8 TFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVLV 57          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.612e-16
Identity = 34/51 (66.67%), Postives = 45/51 (88.24%), Query Frame = 3
Query:   78 GSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            G+   +++++AI+LPP+GVFL++GCG EFWICLLLT LGYIPGIIYAIY +
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAI 53          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 4.612e-16
Identity = 34/51 (66.67%), Postives = 45/51 (88.24%), Query Frame = 3
Query:   78 GSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            G+   +++++AI+LPP+GVFL++GCG EFWICLLLT LGYIPGIIYAIY +
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAI 53          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RC21_ARATH (UPF0057 membrane protein At1g57550 OS=Arabidopsis thaliana GN=At1g57550 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.867e-16
Identity = 38/52 (73.08%), Postives = 45/52 (86.54%), Query Frame = 3
Query:   75 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            MGS  FLEV+ AI +PPVGVFLRYG G+EFW+CLLLT+  +IPG+IYAIYVL
Sbjct:    1 MGS--FLEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIYVL 50          
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.027e-15
Identity = 32/48 (66.67%), Postives = 44/48 (91.67%), Query Frame = 3
Query:   87 TFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230
            T +++ILAI+LPP+GVF ++GCG+EFWICLLLT  GY+PGIIYA++V+
Sbjct:    7 TCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVI 54          
The following BLAST results are available for this feature:
BLAST of CX308548 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
LT01_HORVU3.086e-2086.79Low temperature-induced protein lt101.1 OS=Hordeum... [more]
ESI3_LOPEL3.086e-2086.79Salt stress-induced hydrophobic peptide ESI3 OS=Lo... [more]
LT02_HORVU4.031e-2084.91Low temperature-induced protein lt101.2 OS=Hordeum... [more]
RCI2A_ARATH1.532e-1978.85Hydrophobic protein RCI2A OS=Arabidopsis thaliana ... [more]
RCI2B_ARATH3.194e-1765.38Hydrophobic protein RCI2B OS=Arabidopsis thaliana ... [more]
OSR8_ORYSJ2.704e-1676.00Hydrophobic protein OSR8 OS=Oryza sativa subsp. ja... [more]
LTI6B_ORYSJ4.612e-1666.67Hydrophobic protein LTI6B OS=Oryza sativa subsp. j... [more]
LTI6B_ORYSI4.612e-1666.67Hydrophobic protein LTI6B OS=Oryza sativa subsp. i... [more]
RC21_ARATH7.867e-1673.08UPF0057 membrane protein At1g57550 OS=Arabidopsis ... [more]
LTI6A_ORYSJ1.027e-1566.67Hydrophobic protein LTI6A OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001B11Rv AbsLeaSub1 Citrus clementina cDNA clone C21001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308548 ID=CX308548|Name=CX308548|organism=Citrus clementina|type=EST|length=426bp
GCGGGGGAAGCACTTCTAATTTTTCATCAGTTATCATCATCGGCTGCTGT
TGCTTCTTCTTCTTCTTCTTGTGAATGGGTTCCGAGACTTTCCTAGAAGT
GATTCTGGCCATTCTGCTTCCTCCTGTTGGTGTCTTCCTACGTTATGGCT
GTGGGGTGGAGTTCTGGATATGTTTGTTGCTGACAGTATTGGGCTACATA
CCGGGGATTATATATGCGATTTATGTGTTAGTTGGATGATAAATTAAAAA
TTATGATGTTGTAACGGAGTTAATTTGATATCTTTTTTTTTTTTCTTTTT
TGTCCAAATTTGTTGGTGAACTAATAGATGTAACGTTGACGGTTGGGTTT
GTTAAAAAAAAAAAAAAACCANAAAAAAAAAAAAAAAAAAAAAAAAAGGC
CCANAAAAAAAAAAAAAAAAAAAAAA
back to top