CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC14_ARATH (Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.650e-51
Identity = 87/98 (88.78%), Postives = 93/98 (94.90%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            DLCK PVDGFSAGLVDE NVF+WS SI+GPPDTLYEGGFFNAIM+FP+NYPVSPPTV FTSEMWHPNVY DGKVCISILHPPGDDP+GYELA+ERWTP
Sbjct:   16 DLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC7_ARATH (Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 9.638e-51
Identity = 86/98 (87.76%), Postives = 93/98 (94.90%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            DLCK+PVDGFSAGLVDE N+FEWS +IIGPPDTLYEGGFFNAIMTFP NYP SPPTVRFTS+MWHPNVY DG+VCISILHPPGDDP+GYELA+ERWTP
Sbjct:   15 DLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTP 112          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC13_ARATH (Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.159e-50
Identity = 84/98 (85.71%), Postives = 93/98 (94.90%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            DLCK+PVDGFSAGLVDE N+FEWS +IIGPPDTLYEGGFF AIM+FP NYP SPPTVRFTS++WHPNVYPDG+VCISILHPPGDDP+GYELA+ERWTP
Sbjct:   15 DLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTP 112          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC7_WHEAT (Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 9.660e-43
Identity = 75/93 (80.65%), Postives = 83/93 (89.25%), Query Frame = -2
Query:    1 PVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 279
            P  GF  G VD+SNVFEW  +IIGPP+TLY+GG+FNAIM+FP NYP SPPTVRFTSEMWHPNVYPDG+VCISI HPPGDDPNGYELA+ERWTP
Sbjct:   23 PSMGFQLGFVDDSNVFEWQVTIIGPPETLYDGGYFNAIMSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISI-HPPGDDPNGYELASERWTP 114          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC15_SCHPO (Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe GN=ubc15 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.034e-36
Identity = 63/98 (64.29%), Postives = 80/98 (81.63%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            ++ KNP  GFS GLVD+ ++FEW   IIGP DTLYEGGFF+A ++FP +YP+ PP ++FT+E+WHPNV+P+G+VCISILHPPGDD  GYE A ERW P
Sbjct:   16 EIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC7_CAEEL (Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.805e-34
Identity = 60/98 (61.22%), Postives = 76/98 (77.55%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            D+ + PVDGFSAGLVD++++++W   +IGPPDTLYEGGFF AI+ FP +YP  PP ++F SE+WHPN+  +G VCISILH PGDD  GYE   ERW P
Sbjct:   14 DMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLP 111          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G1_RAT (Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 4.068e-33
Identity = 59/98 (60.20%), Postives = 76/98 (77.55%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L KNPV+GFSAGL+D+++++ W   IIGPPDTLYEGG F A +TFP +YP+ PP ++F +E+WHPNV  +G VCISILH PG+D  GYE   ERW P
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G1_MOUSE (Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 4.068e-33
Identity = 59/98 (60.20%), Postives = 76/98 (77.55%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L KNPV+GFSAGL+D+++++ W   IIGPPDTLYEGG F A +TFP +YP+ PP ++F +E+WHPNV  +G VCISILH PG+D  GYE   ERW P
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G1_HUMAN (Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3)

HSP 1 Score: 139.813 bits (351), Expect = 4.068e-33
Identity = 59/98 (60.20%), Postives = 76/98 (77.55%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L KNPV+GFSAGL+D+++++ W   IIGPPDTLYEGG F A +TFP +YP+ PP ++F +E+WHPNV  +G VCISILH PG+D  GYE   ERW P
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G2_PONAB (Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.546e-32
Identity = 60/97 (61.86%), Postives = 75/97 (77.32%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L  NP +G  AG ++E N FEW A I+GP DT +E G F AI++FP +YP+SPP +RFT EM+HPN+YPDG+VCISILH PGDDP GYE + ERW+P
Sbjct:   16 LTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSP 112          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC14_ARATH5.650e-5188.78Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis ... [more]
UBC7_ARATH9.638e-5187.76Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis t... [more]
UBC13_ARATH8.159e-5085.71Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis ... [more]
UBC7_WHEAT9.660e-4380.65Ubiquitin-conjugating enzyme E2 7 OS=Triticum aest... [more]
UBC15_SCHPO1.034e-3664.29Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccha... [more]
UBC7_CAEEL4.805e-3461.22Probable ubiquitin-conjugating enzyme E2 7 OS=Caen... [more]
UB2G1_RAT4.068e-3360.20Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norve... [more]
UB2G1_MOUSE4.068e-3360.20Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus... [more]
UB2G1_HUMAN4.068e-3360.20Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens... [more]
UB2G2_PONAB1.546e-3261.86Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top