CX308585

Overview
NameCX308585
Unique NameCX308585
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length360
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: FACE1_ARATH (CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 3.558e-61
Identity = 112/119 (94.12%), Postives = 118/119 (99.16%), Query Frame = -2
Query:    3 KGGPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNHT 359
            KGGPYLAIYLWAFMF+LSLVMMT+YPVLIAPLFNKFTPLP+G+LREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKN++EIVAVIAHELGH KLNHT
Sbjct:  176 KGGPYLAIYLWAFMFILSLVMMTIYPVLIAPLFNKFTPLPDGDLREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNEDEIVAVIAHELGHWKLNHT 294          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: FACE1_ORYSJ (CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 9.068e-57
Identity = 104/118 (88.14%), Postives = 112/118 (94.92%), Query Frame = -2
Query:    3 GGPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNHT 356
            GGPYLAIYLW FMF LSLVMMT+YP++IAPLFNKFTPLPEG LREKIEKLA+SL FPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQC +++EIV+VIAHELGH KLNHT
Sbjct:  177 GGPYLAIYLWGFMFALSLVMMTIYPIVIAPLFNKFTPLPEGVLREKIEKLAASLSFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCSSEDEIVSVIAHELGHWKLNHT 294          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: FACE1_HUMAN (CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 8.824e-36
Identity = 78/155 (50.32%), Postives = 98/155 (63.23%), Query Frame = -2
Query:    3 GGPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQ-------------------------------------CKNDEEIVAVIAHELGHRKLNHT 356
            GG Y  IY W F  V+SLV++T+Y   IAPLF+KFTPLPEG+L+E+IE +A S+ FPL K++VV+GS RSSHSNAY YGFFKNKRIVL+DTL+++                                     CKN EE++AV+ HELGH KL HT
Sbjct:  192 GGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKN-EEVLAVLGHELGHWKLGHT 345          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: FACE1_MOUSE (CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 1.966e-35
Identity = 77/155 (49.68%), Postives = 98/155 (63.23%), Query Frame = -2
Query:    3 GGPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQ-------------------------------------CKNDEEIVAVIAHELGHRKLNHT 356
            GG Y  IY W F  V+SLV++T+Y   IAPLF+KFTPLPEG+L+++IE +A S+ FPL K++VV+GS RSSHSNAY YGFFKNKRIVL+DTL+++                                     CKN EE++AV+ HELGH KL HT
Sbjct:  192 GGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGMEARNEGEGDSEEVKAKVKNKKQGCKN-EEVLAVLGHELGHWKLGHT 345          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: STE24_YEAST (CAAX prenyl protease 1 OS=Saccharomyces cerevisiae GN=STE24 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.235e-30
Identity = 63/111 (56.76%), Postives = 82/111 (73.87%), Query Frame = -2
Query:    6 YLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGF-FKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNH 335
            Y+  F+FV+ ++ MT+ PV I P+FNKFTPL +GEL++ IE LA  + FPL K+FV+DGS RSSHSNAY  G  F +KRIVL+DTL+     D EI AV+AHE+GH + NH
Sbjct:  197 YIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTD-EITAVLAHEIGHWQKNH 306          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: STE24_SCHPO (Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe GN=SPAC3H1.05 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.970e-28
Identity = 59/118 (50.00%), Postives = 81/118 (68.64%), Query Frame = -2
Query:    6 KGGPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNH 359
            K G    +Y W    V  L++ T+ P LI PLF KFTPL  G LR +IE+LA+S+ FPLKKL+V+D S RS+HSNA+ YG   NK IVL+DTL++    + E++A++ HELGH  ++H
Sbjct:  225 KFGDNFIMYAWGAYIVFGLILQTIAPSLIMPLFYKFTPLENGSLRTQIEELAASINFPLKKLYVIDASRRSTHSNAFFYGLPWNKGIVLFDTLVKN-HTEPELIAILGHELGHWYMSH 341          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: FACE1_DICDI (CAAX prenyl protease 1 homolog OS=Dictyostelium discoideum GN=zmpste24 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.509e-27
Identity = 61/119 (51.26%), Postives = 79/119 (66.39%), Query Frame = -2
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKK--LFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNHT 353
            GP L  Y W  +  ++L+ +T+YP  I PLFNKFTP+ +GEL E I  LA  + FP  K  +FVVD S R  H NAY YG F  KRIVLYDTL+ +  + EE++AV+ HE GH K++HT
Sbjct:  176 GPQLWFYCWLLLVAITLLSITIYPTFIQPLFNKFTPV-DGELAESIFALAKRVGFPASKDTIFVVDNSKRDGHMNAYFYGLFGTKRIVLYDTLVNEL-DKEELLAVMGHEFGHYKMSHT 292          
BLAST of CX308585 vs. ExPASy Swiss-Prot
Match: YHFN_BACSU (Uncharacterized metalloprotease yhfN OS=Bacillus subtilis GN=yhfN PE=3 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 4.553e-16
Identity = 42/111 (37.84%), Postives = 64/111 (57.66%), Query Frame = -2
Query:    6 IYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHRKLNH 338
            +Y W      SL +  + PV+I PL+N F PL   EL  KI +LA     P   ++ V+ S +++  NAY+ G   NKRIVL+DT + +  +D EI+ ++ HE+GH  + H
Sbjct:  177 LYAWLLTVPFSLFLFFIQPVIIDPLYNDFYPLKNKELESKILELADEANIPADHVYEVNMSEKTNALNAYVTGIGANKRIVLWDTTLNKL-DDSEILFIMGHEMGHYVMKH 286          
The following BLAST results are available for this feature:
BLAST of CX308585 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
FACE1_ARATH3.558e-6194.12CAAX prenyl protease 1 homolog OS=Arabidopsis thal... [more]
FACE1_ORYSJ9.068e-5788.14CAAX prenyl protease 1 homolog OS=Oryza sativa sub... [more]
FACE1_HUMAN8.824e-3650.32CAAX prenyl protease 1 homolog OS=Homo sapiens GN=... [more]
FACE1_MOUSE1.966e-3549.68CAAX prenyl protease 1 homolog OS=Mus musculus GN=... [more]
STE24_YEAST7.235e-3056.76CAAX prenyl protease 1 OS=Saccharomyces cerevisiae... [more]
STE24_SCHPO3.970e-2850.00Probable CAAX prenyl protease 1 OS=Schizosaccharom... [more]
FACE1_DICDI1.509e-2751.26CAAX prenyl protease 1 homolog OS=Dictyostelium di... [more]
YHFN_BACSU4.553e-1637.84Uncharacterized metalloprotease yhfN OS=Bacillus s... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21001E12Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308585 ID=CX308585|Name=CX308585|organism=Citrus clementina|type=EST|length=360bp
TTTGTATGGTTAAGTTTCCGGTGCCCAAGCTCATGAGCTATAACAGCTAC
AATTTCCTCGTCATTTTTGCACTGTTGTATCAAAGTGTCATAAAGGACAA
TTCGCTTATTCTTAAAGAATCCATACATATAGGCATTGCTGTGGCTTGAC
CTTGTGGATCCATCAACTACGAACAACTTCTTTAAAGGAAACTTGAGGGA
GGAGGCAAGTTTCTCAATTTTCTCCCTTAGCTCTCCTTCTGGAAGAGGAG
TAAACTTATTGAACAGAGGGGCAATTAAAACGGGGTATAGTGTCATCATC
ACAAGAGAAAGAACAAACATAAATGCCCAAAGATAGATGGCCAGATAAGG
ACCTCCTTTC
back to top