CX308586

Overview
NameCX308586
Unique NameCX308586
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length447
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig735 contig Ccv1_Contig735:257..703. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 7.083e-56
Identity = 109/124 (87.90%), Postives = 114/124 (91.94%), Query Frame = -1
Query:    1 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 372
            EG+ FTEEQEALVVKSW VMKK   ELGLKFFL+IFEIAPSA+KLFSFL DSNVPLEQN KLK HAMSVFVMTCESAVQLRKAGKVTVRES LKKLGA HFKYGVV+EHFEVTKF+LLETIKEA
Sbjct:    5 EGKVFTEEQEALVVKSWTVMKKKTAELGLKFFLKIFEIAPSAKKLFSFLRDSNVPLEQNTKLKPHAMSVFVMTCESAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKEA 128          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 9.250e-56
Identity = 108/124 (87.10%), Postives = 117/124 (94.35%), Query Frame = -1
Query:    1 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 372
            EGR FTEEQEALVVKSW+ MK NAGELGLKFFL+IFEIAPSAQKLFSFL DSNVPLE+N KLK+HAMSVF+MTCESAVQLRKAGKVTVRES+LKKLGA HFK+GV +EHFEVTKF+LLETIKEA
Sbjct:    5 EGRGFTEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSHAMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKEA 128          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 8.658e-54
Identity = 105/122 (86.07%), Postives = 113/122 (92.62%), Query Frame = -1
Query:    1 RAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 366
            + FTEEQEALVVKSWN MKKN+ ELGLK FL+IFEIAPSAQKLFSFL DS VPLEQN KLK HAMSVF+MTCESAVQLRK+GKVTVRES+LKKLGA HFKYGVV+EHFEVTKF+LLETIKEA
Sbjct:    7 KGFTEEQEALVVKSWNAMKKNSAELGLKLFLKIFEIAPSAQKLFSFLKDSKVPLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKEA 128          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.996e-50
Identity = 101/129 (78.29%), Postives = 114/129 (88.37%), Query Frame = -1
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVKSW VMKKN+ ELGLKFFL+IFEIAPSA+ LFS+L DS +PLEQN KLK HAM+VFVMTCESAVQLRKAGKVTVRES LK+LGA+HFK GVVNEHFE T+F+LLETIKEA
Sbjct:    1 MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKEA 128          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 7.585e-50
Identity = 97/129 (75.19%), Postives = 113/129 (87.60%), Query Frame = -1
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L DS VPLEQN KLK HA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKEA
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEA 129          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 7.585e-50
Identity = 97/129 (75.19%), Postives = 113/129 (87.60%), Query Frame = -1
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L DS VPLEQN KLK HA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKEA
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEA 129          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.430e-48
Identity = 96/126 (76.19%), Postives = 111/126 (88.10%), Query Frame = -1
Query:    1 NEGR-AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 375
            +EG+  FTEEQEALVVKSW+VMKKN+ ELGLK F++IFEIAP+ +K+FSFL DS +P EQN KLK HAMSVFVM CESAVQLRK GKVTVRE+TLK+LGA H KYGVV+EHFEV K++LLETIKEA
Sbjct:    3 SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEA 128          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL_MAIZE (Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 9.272e-48
Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = -1
Query:    1 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 390
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFL DS+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKEA
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEA 132          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL_ZEAMP (Non-symbiotic hemoglobin OS=Zea mays subsp. parviglumis GN=HB PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.211e-47
Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = -1
Query:    1 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 390
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFL DS+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKEA
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEA 132          
BLAST of CX308586 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.066e-47
Identity = 89/121 (73.55%), Postives = 111/121 (91.74%), Query Frame = -1
Query:    1 AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLGDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 363
            +F+EEQEALV+KSW +MKK++  +GL+FFL+IFE+APSA ++FSFL +S+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVR++TLK+LGA HFKYGV + HFEVT+F+LLETIKEA
Sbjct:   16 SFSEEQEALVLKSWAIMKKDSANIGLRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKEA 136          
The following BLAST results are available for this feature:
BLAST of CX308586 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
HBL1_GOSHI7.083e-5687.90Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBP2_CASGL9.250e-5687.10Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_MEDSA8.658e-5486.07Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL_TRETO1.996e-5078.29Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBPL_PARRI7.585e-5075.19Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD7.585e-5075.19Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL1_ARATH1.430e-4876.19Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL_MAIZE9.272e-4871.76Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV... [more]
HBL_ZEAMP1.211e-4771.76Non-symbiotic hemoglobin OS=Zea mays subsp. parvig... [more]
HBL2_ORYSJ2.066e-4773.55Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001F01Rv AbsLeaSub1 Citrus clementina cDNA clone C21001F01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308586 ID=CX308586|Name=CX308586|organism=Citrus clementina|type=EST|length=447bp
TGCCTCTTTTATGGTTTCCAGTAGTGAAAATTTTGTGACCTCAAAATGCT
CATTAACAACACCATATTTGAAGTGGACAGCTCCTAATTTTTTTAGAGTT
GATTCTCTTACTGTCACTTTGCCTGCTTTCCTCAGTTGCACTGCTGATTC
ACACGTCATAACAAAAACAGACATGGCATGGGTCTTGAGCTTCTGGTTCT
GCTCTAGAGGCACATTTGAGTCTCCCAAGAATGAGAACAGCTTTTGGGCT
GATGGTGCAATCTCAAAGATCCTCAAGAAAAATTTAAGACCCAATTCTCC
AGCATTCTTCTTCATTACATTCCATGACTTAACAACTAAAGCTTCTTGCT
CTTCAGTAAAGGCTCTACCTTCGTTAATGTTGGCCATTGATTTCTATTTG
GACACCTGAGGATTGAATGTGATACACAAAATGTTGTTGAATCCCCG
back to top