CX308587

Overview
NameCX308587
Unique NameCX308587
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length547
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10023 contig Ccv1_Contig10023:405..951. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 2.535e-26
Identity = 59/103 (57.28%), Postives = 72/103 (69.90%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKL 309
            LELY N+I+G IP++LGNL  LVS+D+Y N L G IP +   LK L+FLRLNNN L+G IPR LT +  L+V D+SNN L G IPV+G F  F   SF N KL
Sbjct:   97 LELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKL 199          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 2.803e-25
Identity = 59/107 (55.14%), Postives = 73/107 (68.22%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENN-KLNGP 318
            LELY N+I+G IP  LGNL +LVS+D+Y N   G IP+S   L  L+FLRLNNN LTGSIP  LT ++ L+V D+SNN L G++P +G F  F   SF NN  L GP
Sbjct:   98 LELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGP 204          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 3.099e-24
Identity = 57/103 (55.34%), Postives = 72/103 (69.90%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKL 309
            LELY N+I+G+IP+ELG+L  LVS+D+Y N + G IP S   L  L+FLRLNNN L+G IP  LT++  L+V D+SNN L G IPV+G F  F   SF NN L
Sbjct:  104 LELYSNNITGEIPEELGDLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNNSLSGEIPMTLTSV-QLQVLDISNNRLSGDIPVNGSFSLFTPISFANNSL 205          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: SERK5_ARATH (Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 4.047e-24
Identity = 57/103 (55.34%), Postives = 71/103 (68.93%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKL 309
            LEL+ N+I+G+IP+ELG+L  LVS+D++ N + G IP S   L  L+FLRL NN L+G IPR LT L  L V D+SNN L G IPV+G F  F   SF NNKL
Sbjct:   99 LELFNNNITGEIPEELGDLMELVSLDLFANNISGPIPSSLGKLGKLRFLRLYNNSLSGEIPRSLTAL-PLDVLDISNNRLSGDIPVNGSFSQFTSMSFANNKL 200          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.903e-24
Identity = 57/107 (53.27%), Postives = 71/107 (66.36%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENN-KLNGP 318
            LELY N+I+G +P +LGNL +LVS+D+Y N   G IP S   L  L+FLRLNNN LTG IP  LT +  L+V D+SNN L G++P +G F  F   SF NN  L GP
Sbjct:  101 LELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGP 207          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 93.2041 bits (230), Expect = 8.733e-19
Identity = 51/105 (48.57%), Postives = 66/105 (62.86%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKLNG 315
            +EL  N++SG I +E GNLK L   D+  N L G IP S + + SL+ L L+NN+L+GSIP  L  LS L  F V+ N L G IP  G F++FP  SFE+N L G
Sbjct:  528 IELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKFSVAYNNLSGVIPSGGQFQTFPNSSFESNHLCG 632          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.378e-16
Identity = 47/108 (43.52%), Postives = 65/108 (60.19%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPME---SFENNKLNG 315
            L +Y ND+ G IP+E+ ++K L  +D+  NK  G+IP  F+ L+SL +L L  NK  GSIP  L +LS L  FD+S+N L GTIP +       M+   +F NN L G
Sbjct:  532 LRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTG 639          

HSP 2 Score: 76.2554 bits (186), Expect = 1.105e-13
Identity = 41/106 (38.68%), Postives = 60/106 (56.60%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIP-VDGPFRSFPMESFENNKLNG 315
            L++  N ++G IP+E+GNLK L  + ++ N   G IP+  +NL  L+ LR+ +N L G IP E+  +  L V D+SNN   G IP +     S    S + NK NG
Sbjct:  484 LQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNG 589          

HSP 3 Score: 72.0182 bits (175), Expect = 2.083e-12
Identity = 42/106 (39.62%), Postives = 57/106 (53.77%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNG 315
            L L  N + G IP E+GN  SLV +++Y N+L G+IP    NL  L+ LR+  NKLT SIP  L  L+ L    +S N L G I  + G   S  + +  +N   G
Sbjct:  245 LVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTG 350          

HSP 4 Score: 71.633 bits (174), Expect = 2.721e-12
Identity = 41/117 (35.04%), Postives = 62/117 (52.99%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKLNGPELQGLVPYDFG 351
            L LY+N  SG IP  +  LK++  +D+  N L G++P+      SL  +  + N LTG IP  L  L  L++F  + N L G+IPV        + +  +  L+G +L G +P DFG
Sbjct:  125 LILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVS----IGTLANLTDLDLSGNQLTGKIPRDFG 237          

HSP 5 Score: 71.633 bits (174), Expect = 2.721e-12
Identity = 46/131 (35.11%), Postives = 63/131 (48.09%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFAN------------------------LKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNGP 318
            LELY N ++GKIP ELGNL  L ++ +Y+NKL   IP S                           L+SL+ L L++N  TG  P+ +T L +L V  V  N + G +P D G   +    S  +N L GP
Sbjct:  269 LELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGP 399          

HSP 6 Score: 71.633 bits (174), Expect = 2.721e-12
Identity = 37/102 (36.27%), Postives = 58/102 (56.86%), Query Frame = 1
Query:    1 LELYMNDISGKIPKEL-GNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENN 303
            L+   N++SG IP E+   +  ++S+++ +N   GEIP+SF N+  L  L L++N LTG IP  L  LS LK   +++N L G +P  G F++        N
Sbjct:  678 LDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGN 779          

HSP 7 Score: 70.8626 bits (172), Expect = 4.641e-12
Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIP 255
            L+L  N ++GKIP++ GNL +L S+ + +N LEG+IP    N  SL  L L +N+LTG IP EL  L  L+   +  N L  +IP
Sbjct:  221 LDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIP 305          

HSP 8 Score: 69.3218 bits (168), Expect = 1.350e-11
Identity = 37/84 (44.05%), Postives = 51/84 (60.71%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFD-VSNNGLCGT 249
            L L  N  SG+IP+  GN+  LVS+D+  N L GEIP+S ANL +LK L+L +N L G +P E     ++   D + N  LCG+
Sbjct:  703 LNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVP-ESGVFKNINASDLMGNTDLCGS 785          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.378e-16
Identity = 45/105 (42.86%), Postives = 61/105 (58.10%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKLNG 315
            L+L  N + G IPKELG +  L  +++  N L G IP+    LK++  L L+ N+  G+IP  LT+L+ L   D+SNN L G IP   PF +FP   F NN L G
Sbjct:  668 LDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAPFDTFPDYRFANNSLCG 772          

HSP 2 Score: 73.9442 bits (180), Expect = 5.483e-13
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNG 315
            L L++N +SG+IP+EL  L++L ++ +  N L G IP S +N   L ++ L+NN+L+G IP  L  LS+L +  + NN + G IP + G  +S        N LNG
Sbjct:  480 LILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNG 585          

HSP 3 Score: 68.9366 bits (167), Expect = 1.764e-11
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNG 315
            L+L  N ++G IP  LG+L  L  + ++ N+L GEIP+    L++L+ L L+ N LTG IP  L+  + L    +SNN L G IP   G   +  +    NN ++G
Sbjct:  456 LDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISG 561          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.378e-16
Identity = 45/105 (42.86%), Postives = 61/105 (58.10%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKLNG 315
            L+L  N + G IPKELG +  L  +++  N L G IP+    LK++  L L+ N+  G+IP  LT+L+ L   D+SNN L G IP   PF +FP   F NN L G
Sbjct:  668 LDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAPFDTFPDYRFANNSLCG 772          

HSP 2 Score: 73.9442 bits (180), Expect = 5.483e-13
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNG 315
            L L++N +SG+IP+EL  L++L ++ +  N L G IP S +N   L ++ L+NN+L+G IP  L  LS+L +  + NN + G IP + G  +S        N LNG
Sbjct:  480 LILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNG 585          

HSP 3 Score: 68.9366 bits (167), Expect = 1.764e-11
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVD-GPFRSFPMESFENNKLNG 315
            L+L  N ++G IP  LG+L  L  + ++ N+L GEIP+    L++L+ L L+ N LTG IP  L+  + L    +SNN L G IP   G   +  +    NN ++G
Sbjct:  456 LDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISG 561          
BLAST of CX308587 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.919e-16
Identity = 46/104 (44.23%), Postives = 62/104 (59.62%), Query Frame = 1
Query:    1 LELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIPVDGPFRSFPMESFENNKLN 312
            L L  N I+G+IP++ GNL SL S+D+  N+L G IP +  NLK L+FL L+ NKL G+IP  LT L +L    + +N L G IP        P  +F +N LN
Sbjct:   99 LTLKGNGITGEIPEDFGNLTSLTSLDLEDNQLTGRIPSTIGNLKKLQFLTLSRNKLNGTIPESLTGLPNLLNLLLDSNSLSGQIPQS--LFEIPKYNFTSNNLN 200          
The following BLAST results are available for this feature:
BLAST of CX308587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
BAK1_ARATH2.535e-2657.28BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
SERK1_ARATH2.803e-2555.14Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
SERK4_ARATH3.099e-2455.34Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]
SERK5_ARATH4.047e-2455.34Somatic embryogenesis receptor kinase 5 OS=Arabido... [more]
SERK2_ARATH6.903e-2453.27Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
PSKR1_ARATH8.733e-1948.57Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
FLS2_ARATH2.378e-1643.52LRR receptor-like serine/threonine-protein kinase ... [more]
BRI1_SOLPE2.378e-1642.86Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC2.378e-1642.86Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
Y5129_ARATH6.919e-1644.23Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001F02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001F02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308587 ID=CX308587|Name=CX308587|organism=Citrus clementina|type=EST|length=547bp
TTGGAGCTTTACATGAATGACATAAGTGGGAAAATTCCGAAAGAGTTAGG
TAATTTGAAAAGCCTTGTCAGCATGGATATGTATCAGAATAAACTGGAAG
GAGAAATACCAAAGTCCTTTGCCAATTTGAAGTCACTTAAATTTCTGCGG
TTGAACAACAACAAACTAACAGGATCAATTCCGAGGGAGCTGACCACCCT
GTCGGACCTCAAAGTTTTTGATGTTTCTAACAATGGTCTCTGTGGGACAA
TCCCTGTTGATGGTCCTTTTAGAAGCTTTCCTATGGAGAGTTTTGAAAAT
AATAAACTCAATGGACCAGAGCTGCAAGGACTGGTGCCTTATGATTTTGG
ATGCTGAAGAAGGTTGAAAACCCTCCGTCTTCTATTGAAGACCATAATGT
TAAAGACTCGTATAGGGTAAAATTATATCGTGTGCATCAGCTTGATCGAA
TGGCTAGATATATTATGTCAGCGGCAGTGACTGTTCATGTATGAAGTAAC
TAAAGCAATTAAAATAAGATTATGTAAGCTTATTTAAAAATCCACAA
back to top