CX308591

Overview
NameCX308591
Unique NameCX308591
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length480
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12981 contig Ccv1_Contig12981:387..866. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: LPAT_MAIZE (1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 OS=Zea mays GN=PLS1 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.403e-66
Identity = 121/159 (76.10%), Postives = 133/159 (83.65%), Query Frame = -3
Query:    2 RINRXXXXXXXXXXXXXXXXWAGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 478
            RINR                WAGVK++L  D E YR MGKEHAL++SNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF+EYLFLER+WAKDE TLK GLQRL+D+P+PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct:   44 RINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGKEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP 202          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: LPAT2_ARATH (1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=LPAT2 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.393e-66
Identity = 119/138 (86.23%), Postives = 128/138 (92.75%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            AGVKI++F D E +  MGKEHALVV NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRL D+P+PFWLALFVEGTRFT+AKL AAQEYAAS+ LPIPRNVLIP
Sbjct:   64 AGVKIQVFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELPIPRNVLIP 201          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: LPAT2_BRAOL (1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica oleracea GN=LPAT2 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 9.093e-66
Identity = 117/138 (84.78%), Postives = 128/138 (92.75%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            AGVKI++F D E +  MGKEHALVV NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRL D+P+PFWLALFVEGTRFT+AKL AAQEYAA++ LP+PRNVLIP
Sbjct:   65 AGVKIQVFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAATSQLPVPRNVLIP 202          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: LPAT2_BRANA (1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Brassica napus GN=LPAT2 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.188e-65
Identity = 117/138 (84.78%), Postives = 128/138 (92.75%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            AGVKI++F D E +  MGKEHALVV NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTL+SGLQRL D+P+PFWLALFVEGTRFT+AKL AAQEYAAS+ LP+PRNVLIP
Sbjct:   64 AGVKIQVFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELPVPRNVLIP 201          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: LPAT3_ARATH (1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=LPAT3 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.030e-57
Identity = 100/138 (72.46%), Postives = 120/138 (86.96%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            A +KI L+VD E   L+GKEHALV+SNH+SDIDWL+GWV+AQR GCLGS+LA+MKK +K+LP+IGWSMWFS+Y+FLER+WAKDE+TLK+G +RL D+P  FWLALFVEGTRFTQ KL AAQEYA+   LP PRNVLIP
Sbjct:   65 ACIKINLYVDAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKKEAKYLPIIGWSMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASIRSLPSPRNVLIP 202          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: PLCC_PONAB (1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Pongo abelii GN=AGPAT3 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.713e-30
Identity = 57/132 (43.18%), Postives = 85/132 (64.39%), Query Frame = -3
Query:    2 LFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 397
            LF D+      GKEHA+++ NH  +ID+L GW + +R G LGS+  + KK   ++P+IGW+ +F E +F +R W +D  T+  GL+RL DYP+  W  L+ EGTRFT+ K   + E AA+ GLP+ +  L+P
Sbjct:   75 LFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLP 206          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: PLCC_HUMAN (1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens GN=AGPAT3 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.713e-30
Identity = 57/132 (43.18%), Postives = 85/132 (64.39%), Query Frame = -3
Query:    2 LFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 397
            LF D+      GKEHA+++ NH  +ID+L GW + +R G LGS+  + KK   ++P+IGW+ +F E +F +R W +D  T+  GL+RL DYP+  W  L+ EGTRFT+ K   + E AA+ GLP+ +  L+P
Sbjct:   75 LFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLP 206          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: PLCD_PONAB (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Pongo abelii GN=AGPAT4 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.161e-28
Identity = 57/138 (41.30%), Postives = 88/138 (63.77%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            +G +  +F D  AY   GKE+A+VV NHK +ID+L GW L++R G LG +  + KK   ++P+IGW  +F+E +F  R W +D  T+ + LQ LRDYP+ ++  +  EGTRFT+ K   + + A + GLP  ++ L+P
Sbjct:   69 SGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLP 206          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: PLCD_HUMAN (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens GN=AGPAT4 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.161e-28
Identity = 57/138 (41.30%), Postives = 88/138 (63.77%), Query Frame = -3
Query:    2 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP 415
            +G +  +F D  AY   GKE+A+VV NHK +ID+L GW L++R G LG +  + KK   ++P+IGW  +F+E +F  R W +D  T+ + LQ LRDYP+ ++  +  EGTRFT+ K   + + A + GLP  ++ L+P
Sbjct:   69 SGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLP 206          
BLAST of CX308591 vs. ExPASy Swiss-Prot
Match: PLCD_MACFA (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Macaca fascicularis GN=AGPAT4 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 7.525e-28
Identity = 55/130 (42.31%), Postives = 83/130 (63.85%), Query Frame = -3
Query:   26 AGVKIKLFVDREAYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP 415
            +G +  +F D  AY   GKE+A+VV NHK +ID+L GW L++R G LG +  + KK   ++P+IGW  +F+E +F  R W +D  T+ + LQ LRDYP+ ++  +  EGTRFT+ K   + + A + GLP
Sbjct:   69 SGTECTIFTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLP 198          
The following BLAST results are available for this feature:
BLAST of CX308591 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
LPAT_MAIZE1.403e-6676.101-acyl-sn-glycerol-3-phosphate acyltransferase PLS... [more]
LPAT2_ARATH2.393e-6686.231-acyl-sn-glycerol-3-phosphate acyltransferase 2 O... [more]
LPAT2_BRAOL9.093e-6684.781-acyl-sn-glycerol-3-phosphate acyltransferase 2 O... [more]
LPAT2_BRANA1.188e-6584.781-acyl-sn-glycerol-3-phosphate acyltransferase 2 O... [more]
LPAT3_ARATH2.030e-5772.461-acyl-sn-glycerol-3-phosphate acyltransferase 3 O... [more]
PLCC_PONAB4.713e-3043.181-acyl-sn-glycerol-3-phosphate acyltransferase gam... [more]
PLCC_HUMAN4.713e-3043.181-acyl-sn-glycerol-3-phosphate acyltransferase gam... [more]
PLCD_PONAB1.161e-2841.301-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
PLCD_HUMAN1.161e-2841.301-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
PLCD_MACFA7.525e-2842.311-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001F06Rv AbsLeaSub1 Citrus clementina cDNA clone C21001F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308591 ID=CX308591|Name=CX308591|organism=Citrus clementina|type=EST|length=480bp
AAGGAATTAAAACATTTCTAGGAATAGGCAATCCTGTTGAAGCAGCATAT
TCCTGAGCTGCTAAAAGCTTAGCCTGTGTAAATCGAGTTCCTTCTACAAA
GAGAGCTAACCAAAAGGGTTGAGGATAGTCTCTTAGACGTTGGAGACCTG
ACTTTAATGTGCTCTCATCCTTTGCCCAGTTTCTTTCCAGAAAGAGATAT
TCAGAAAACCACATTGACCAACCTATGACCGGAAGAAATTTTGATGATTT
CTTCATAACGGCCAATGTGCTACCAAGACAACCTGACCGCTGAGCCAAAA
CCCACCCAACAAGCCAGTCAATGTCACTTTTGTGATTGGAAACAACAAGT
GCATGTTCTTTACCCATTAATCGATACGCTTCACGGTCTACGAAAAGTTT
GATCTTAACTCCGGCCCACCAATCAACTATCCATACAAGTTCCAGCCATA
ACAATTCCGCTACCCATCTATTGATTCTCC
back to top