CX308593

Overview
NameCX308593
Unique NameCX308593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length305
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7413 contig Ccv1_Contig7413:593..898. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308593 vs. ExPASy Swiss-Prot
Match: CAX2_ARATH (Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 2.482e-22
Identity = 52/98 (53.06%), Postives = 68/98 (69.39%), Query Frame = 3
Query:   12 SMHEFEDESLFTPEAEPEKIQRVHGLQDGSVSGDFPSSGNKILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERL 305
            S +E E++SLF  E +  + +    ++ GS+S  FP    K  +NSV  SIK V+F NKLNLL+PFGPLAI+VH +   KGWVF L+L+GITPLAERL
Sbjct:   18 SANELENKSLFRQEEDATQTKEASLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPLAILVHYMIDSKGWVFLLTLVGITPLAERL 115          
BLAST of CX308593 vs. ExPASy Swiss-Prot
Match: CAX5_ARATH (Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.985e-21
Identity = 48/97 (49.48%), Postives = 67/97 (69.07%), Query Frame = 3
Query:   15 MHEFEDESLFTPEAEPEKIQRVHGLQDGSVSGDFPSSGNKILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERL 305
            +++ E +SLF  + +  + +    ++ GS+S  F     K   NSV +S K V+ SNKLNLL+PFGPLAI++H LT +KGW+F LSL+GITPLAERL
Sbjct:   19 VNDVEHKSLFRRDTDSPERKAASLMEQGSLSASFRECSTKTPNNSVLQSFKIVILSNKLNLLLPFGPLAILLHYLTDNKGWIFLLSLVGITPLAERL 115          
BLAST of CX308593 vs. ExPASy Swiss-Prot
Match: CAX6_ARATH (Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3)

HSP 1 Score: 87.8113 bits (216), Expect = 1.841e-17
Identity = 48/97 (49.48%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   15 MHEFEDESLFTPEAEPEKIQRVHGLQDGSVSGDFPSSGNKILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERL 305
            ++E E +SL   E +  +      ++ GS+         K  +NSV +S K V+ SNKLNLL+PFGPLAI+VH LT +KGW F LSL+GITPLAERL
Sbjct:   34 VNEVELKSLLEQETDSPQTNAASLMEQGSLR----ERRAKAPRNSVVQSFKIVILSNKLNLLLPFGPLAILVHYLTDNKGWFFLLSLVGITPLAERL 126          
BLAST of CX308593 vs. ExPASy Swiss-Prot
Match: CAX3_ORYSJ (Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 2.329e-12
Identity = 37/74 (50.00%), Postives = 49/74 (66.22%), Query Frame = 3
Query:   87 LQDGSVSGDFPSSGN-KILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERL 305
            LQ+G +      S N +    S  RSI+ V+F++KLNLL+PFGP +I++H  T   G VF  S+LGITPLAERL
Sbjct:   18 LQNGGLRSSMVQSWNLQRFVESALRSIRIVIFTSKLNLLLPFGPASIILHYTTSRHGLVFLFSMLGITPLAERL 91          
BLAST of CX308593 vs. ExPASy Swiss-Prot
Match: CAX2_ORYSJ (Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 1.156e-11
Identity = 30/50 (60.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:  159 SIKTVVFSNKLNLLMPFGPLAIMVHNLT-GHKGWVFFLSLLGITPLAERL 305
            S++ V+   K+N+L+PFGPLA+M+H L+  H+GWVF  SL+GITPLAERL
Sbjct:   63 SVRVVILQAKINVLLPFGPLAVMLHYLSANHQGWVFLFSLIGITPLAERL 112          
The following BLAST results are available for this feature:
BLAST of CX308593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CAX2_ARATH2.482e-2253.06Vacuolar cation/proton exchanger 2 OS=Arabidopsis ... [more]
CAX5_ARATH7.985e-2149.48Vacuolar cation/proton exchanger 5 OS=Arabidopsis ... [more]
CAX6_ARATH1.841e-1749.48Putative vacuolar cation/proton exchanger 6 OS=Ara... [more]
CAX3_ORYSJ2.329e-1250.00Vacuolar cation/proton exchanger 3 OS=Oryza sativa... [more]
CAX2_ORYSJ1.156e-1160.00Vacuolar cation/proton exchanger 2 OS=Oryza sativa... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21001F08Rv AbsLeaSub1 Citrus clementina cDNA clone C21001F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308593 ID=CX308593|Name=CX308593|organism=Citrus clementina|type=EST|length=305bp
GCGGGGATAGATCGATGCATGAGTTTGAGGATGAGAGTCTCTTTACTCCG
GAAGCAGAGCCTGAAAAGATACAACGTGTGCATGGACTTCAAGATGGATC
AGTTTCTGGGGATTTCCCTTCTAGTGGGAACAAAATTTTGCAGAATAGTG
TATGTAGGAGTATAAAGACTGTAGTTTTTTCAAATAAACTGAACTTGCTT
ATGCCTTTTGGCCCTCTTGCAATCATGGTTCACAATTTGACTGGTCATAA
AGGATGGGTGTTCTTTTTGAGCTTGCTGGGTATAACACCTTTGGCAGAGC
GTTTA
back to top