CX308602

Overview
NameCX308602
Unique NameCX308602
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length447
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.105e-56
Identity = 109/123 (88.62%), Postives = 114/123 (92.68%), Query Frame = 2
Query:   77 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            EG+ FTEEQEALVVKSW VMKK   ELGLKFFL+IFEIAPSA+KLFSFLRDSNVPLEQN KLK HAMSVFVMTCESAVQLRKAGKVTVRES LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    5 EGKVFTEEQEALVVKSWTVMKKKTAELGLKFFLKIFEIAPSAKKLFSFLRDSNVPLEQNTKLKPHAMSVFVMTCESAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 9.035e-56
Identity = 107/123 (86.99%), Postives = 117/123 (95.12%), Query Frame = 2
Query:   77 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            EGR FTEEQEALVVKSW+ MK NAGELGLKFFL+IFEIAPSAQKLFSFL+DSNVPLE+N KLK+HAMSVF+MTCESAVQLRKAGKVTVRES+LKKLGA HFK+GV +EHFEVTKF+LLETIKE
Sbjct:    5 EGRGFTEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSHAMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKE 127          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 8.457e-54
Identity = 104/121 (85.95%), Postives = 113/121 (93.39%), Query Frame = 2
Query:   83 RAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            + FTEEQEALVVKSWN MKKN+ ELGLK FL+IFEIAPSAQKLFSFL+DS VPLEQN KLK HAMSVF+MTCESAVQLRK+GKVTVRES+LKKLGA HFKYGVV+EHFEVTKF+LLETIKE
Sbjct:    7 KGFTEEQEALVVKSWNAMKKNSAELGLKLFLKIFEIAPSAQKLFSFLKDSKVPLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKE 127          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.950e-50
Identity = 100/128 (78.12%), Postives = 114/128 (89.06%), Query Frame = 2
Query:   62 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            M++    + FTEEQEALVVKSW VMKKN+ ELGLKFFL+IFEIAPSA+ LFS+L+DS +PLEQN KLK HAM+VFVMTCESAVQLRKAGKVTVRES LK+LGA+HFK GVVNEHFE T+F+LLETIKE
Sbjct:    1 MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKE 127          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 7.408e-50
Identity = 96/128 (75.00%), Postives = 113/128 (88.28%), Query Frame = 2
Query:   62 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLK HA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 7.408e-50
Identity = 96/128 (75.00%), Postives = 113/128 (88.28%), Query Frame = 2
Query:   62 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLK HA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKE
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKE 128          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 6.272e-49
Identity = 96/125 (76.80%), Postives = 111/125 (88.80%), Query Frame = 2
Query:   74 NEGR-AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            +EG+  FTEEQEALVVKSW+VMKKN+ ELGLK F++IFEIAP+ +K+FSFLRDS +P EQN KLK HAMSVFVM CESAVQLRK GKVTVRE+TLK+LGA H KYGVV+EHFEV K++LLETIKE
Sbjct:    3 SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKE 127          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL_MAIZE (Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 4.065e-48
Identity = 94/130 (72.31%), Postives = 114/130 (87.69%), Query Frame = 2
Query:   59 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL_ZEAMP (Non-symbiotic hemoglobin OS=Zea mays subsp. parviglumis GN=HB PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 5.309e-48
Identity = 94/130 (72.31%), Postives = 114/130 (87.69%), Query Frame = 2
Query:   59 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKE
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKE 131          
BLAST of CX308602 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 9.056e-48
Identity = 89/120 (74.17%), Postives = 111/120 (92.50%), Query Frame = 2
Query:   86 AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKTHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 445
            +F+EEQEALV+KSW +MKK++  +GL+FFL+IFE+APSA ++FSFLR+S+VPLE+N KLKTHAMSVFVMTCE+A QLRKAGKVTVR++TLK+LGA HFKYGV + HFEVT+F+LLETIKE
Sbjct:   16 SFSEEQEALVLKSWAIMKKDSANIGLRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKE 135          
The following BLAST results are available for this feature:
BLAST of CX308602 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
HBL1_GOSHI3.105e-5688.62Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBP2_CASGL9.035e-5686.99Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_MEDSA8.457e-5485.95Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL_TRETO1.950e-5078.13Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBPL_PARRI7.408e-5075.00Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD7.408e-5075.00Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL1_ARATH6.272e-4976.80Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL_MAIZE4.065e-4872.31Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV... [more]
HBL_ZEAMP5.309e-4872.31Non-symbiotic hemoglobin OS=Zea mays subsp. parvig... [more]
HBL2_ORYSJ9.056e-4874.17Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G05Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308602 ID=CX308602|Name=CX308602|organism=Citrus clementina|type=EST|length=447bp
GCGGGGATTCAACAACATTTTGTGTATCACATTCAATCCTCAGGTGTCCA
AATAGAAATCAATGGCCAACATTAACGAAGGTAGAGCCTTTACTGAAGAG
CAAGAAGCTTTAGTTGTCAAGTCATGGAATGTAATGAAGAAGAATGCTGG
AGAATTGGGTCTTAAATTCTTCTTGAGGATCTTTGAGATTGCACCATCAG
CCCAAAAGCTGTTCTCATTCTTGAGAGACTCAAATGTGCCTCTAGAGCAG
AACCAGAAGCTCAAGACCCATGCCATGTCTGTTTTTGTTATGACGTGTGA
ATCAGCAGTGCAACTGAGGAAAGCAGGCAAAGTGACAGTAAGAGAATCAA
CTCTAAAAAAATTAGGAGCTGTCCACTTCAAATATGGTGTTGTTAATGAG
CATTTTGAGGTCACAAAATTTTCACTACTGGAAACCATAAAAGAGGC
back to top