CX308861

Overview
NameCX308861
Unique NameCX308861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length376
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15153 contig Ccv1_Contig15153:199..574. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G3_ORYSJ (Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.920e-51
Identity = 93/124 (75.00%), Postives = 111/124 (89.52%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV+V+L +NFEMGV+NK+PEFLKMNPLGK+PVLETP+G VFESNAIARYVARLK ++ LCGSSLIDY+H+EQWMDFSA E+DANI RWLYPRLG+  Y+P+ EE A+ +LKR+L ALN HLASN
Sbjct:   25 GVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETPEGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFGPYVPVLEEFAITSLKRSLGALNTHLASN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G_PRUAV (Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.244e-50
Identity = 93/124 (75.00%), Postives = 109/124 (87.90%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV+V+LA +FEMGVTNK+PE+LK+NP+GKVP+LETPDGP+FESNAIARYVARLKADN L GSSLIDYAH+EQW+DF ++EIDANI  W  PR GY  Y+P AEE A++ALKRAL ALN HLASN
Sbjct:   25 GVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLETPDGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGYAVYLPPAEEAAISALKRALGALNTHLASN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G2_ORYSJ (Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 1.625e-50
Identity = 92/124 (74.19%), Postives = 109/124 (87.90%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV+V+L +NF+MGV+NK+PEFLKMNP+GK+PVLETPDGPVFESNAIARYV R KADN L GSSLI+YAH+EQW DFSA E+DANI +WLYPRLG   Y+ ++EE A+AALKR+L ALN HLASN
Sbjct:   25 GVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETPDGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIAPYVAVSEEAAIAALKRSLGALNTHLASN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G1_ORYSJ (Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.729e-50
Identity = 89/124 (71.77%), Postives = 111/124 (89.52%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV+V+LA+NF+MGV+NK+PE+LKMNP+GKVP+LETPDGPVFESNAIARYV R K+DN L GSSLI+YAH+EQW+DFSA E+DAN  +WL+PRLG+  Y+ ++EE A+AALKR+L ALN HLASN
Sbjct:   25 GVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDGPVFESNAIARYVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWLFPRLGFAPYVAVSEEAAIAALKRSLGALNTHLASN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G2_ARATH (Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.143e-46
Identity = 84/124 (67.74%), Postives = 106/124 (85.48%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV+++ + +F+MGVTNKSPEFLKMNP+GKVPVLETP+GP+FESNAIARYV+R   DN L GSSLI+YAH+EQW+DFS++EIDAN+ +W  PR+GY  +   AEE A++ALKR L+ALN HLASN
Sbjct:   25 GVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETPEGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYAPFSAPAEEAAISALKRGLEALNTHLASN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G1_ARATH (Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.333e-44
Identity = 84/124 (67.74%), Postives = 103/124 (83.06%), Query Frame = -3
Query:    3 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASN 374
            GV++ +  +F+MGVTNK+P FLKMNP+GKVPVLETP+G VFESNAIARYV+RL  DN L GSSLI+YA +EQW+DFS++EI A+I RW  PR+G+M Y   AEEGA++ LKRALDALN HL SN
Sbjct:   25 GVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETPEGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFMPYSAPAEEGAISTLKRALDALNTHLTSN 148          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1GA_XENLA (Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-A PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.305e-19
Identity = 56/125 (44.80%), Postives = 74/125 (59.20%), Query Frame = -3
Query:   12 GVEVKLAEN---FEMGVTNKSPEFLKMNPLGKVPVLETPDG-PVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHL 374
            G  +K+A +   F+ GVTNK+PEFLK  PLGKVP  E  DG  +FES+AIA YV     +++L G++ +  A V QW+ FS   I    S W++P LG MQY   A E A   +K  L  L+ HL
Sbjct:   26 GFPIKVASSAPEFQFGVTNKTPEFLKKFPLGKVPAFEGKDGFCLFESSAIAHYVG----NDELRGTTRLHQAQVIQWVSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEGIKTVLGVLDSHL 146          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G_ARTSA (Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.063e-17
Identity = 54/122 (44.26%), Postives = 73/122 (59.84%), Query Frame = -3
Query:   12 GVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETPDGP-VFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHL 374
            G ++++A++F  G TNKS  FLK  PLGKVP  E+ DG  + ESNAIA YVA    +  L GSS ++ A + QWM F+  EI      W++P LG MQ+   A   A   + +AL AL+ HL
Sbjct:   26 GAKLEIAKSFVFGETNKSDAFLKSFPLGKVPAFESADGHCIAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGIMQFNKQATARAKEDIDKALQALDDHL 143          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1GB_XENLA (Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-B PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.005e-16
Identity = 51/114 (44.74%), Postives = 69/114 (60.53%), Query Frame = -3
Query:   12 FEMGVTNKSPEFLKMNPLGKVPVLETPDG-PVFESNAIARYVARLKADNQLCGS-SLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHL 347
            F+ G+TNK+PEFLK  PLGKVP  E  +G  +FES+AIA YV    A+++L GS + +  A V QW+ FS   +    S W++P LG MQ+   A E A   +K  L  L+ HL
Sbjct:   38 FQFGLTNKTPEFLKKFPLGKVPAFEGNNGFCLFESSAIAHYV----ANDELRGSNNRLHQAQVIQWVGFSDSHVVPPASAWVFPTLGIMQFNKQATEQAKEEIKTVLGVLDCHL 147          
BLAST of CX308861 vs. ExPASy Swiss-Prot
Match: EF1G_RAT (Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 3.420e-16
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = -3
Query:   12 NFEMGVTNKSPEFLKMNPLGKVPVLETPDG-PVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHL 350
            +F  G TN++PEFL+  P GKVP  E  DG  VFESNAIA YV+    + +L GS+    A V QW+ F+  +I    S W++P LG M +   A E A   +KR L  L+ HL
Sbjct:   37 HFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVS----NEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHL 146          
The following BLAST results are available for this feature:
BLAST of CX308861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
EF1G3_ORYSJ1.920e-5175.00Elongation factor 1-gamma 3 OS=Oryza sativa subsp.... [more]
EF1G_PRUAV1.244e-5075.00Elongation factor 1-gamma OS=Prunus avium PE=2 SV=... [more]
EF1G2_ORYSJ1.625e-5074.19Elongation factor 1-gamma 2 OS=Oryza sativa subsp.... [more]
EF1G1_ORYSJ4.729e-5071.77Elongation factor 1-gamma 1 OS=Oryza sativa subsp.... [more]
EF1G2_ARATH4.143e-4667.74Probable elongation factor 1-gamma 2 OS=Arabidopsi... [more]
EF1G1_ARATH1.333e-4467.74Probable elongation factor 1-gamma 1 OS=Arabidopsi... [more]
EF1GA_XENLA3.305e-1944.80Elongation factor 1-gamma-A OS=Xenopus laevis GN=e... [more]
EF1G_ARTSA1.063e-1744.26Elongation factor 1-gamma OS=Artemia salina PE=1 S... [more]
EF1GB_XENLA2.005e-1644.74Elongation factor 1-gamma-B OS=Xenopus laevis GN=e... [more]
EF1G_RAT3.420e-1643.86Elongation factor 1-gamma OS=Rattus norvegicus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21004F10Rv AbsLeaSub1 Citrus clementina cDNA clone C21004F10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308861 ID=CX308861|Name=CX308861|organism=Citrus clementina|type=EST|length=376bp
GTATTTGAAGCCAAATGAATGTTCAAAGCATCCAATGCTCTCTTCAGTGC
GGCAACAGCACCTTCCTCAGCCAGAGGAATGTATTGCATATATCCAAGTC
TTGGATATAACCACCTGGAGATATTAGCATCAATCTCCATGGCAGAAAAA
TCCATCCACTGCTCAACATGAGCATAATCGATCAGAGAAGAACCACATAG
TTGATTGTCAGCTTTCAGACGTGCAACATAACGGGCAATGGCATTGCTCT
CAAAAACCGGACCATCAGGTGTCTCCAACACAGGAACCTTCCCAAGAGGG
TTCATCTTCAAAAATTCAGGGGATTTATTAGTGACACCCATCTCAAAATT
CTCAGCCAATTTGACTTCCACACCAG
back to top