CX308867

Overview
NameCX308867
Unique NameCX308867
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8171 contig Ccv1_Contig8171:886..1574. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_ARATH (COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana GN=CSN1 PE=1 SV=2)

HSP 1 Score: 329.717 bits (844), Expect = 8.820e-90
Identity = 163/190 (85.79%), Postives = 179/190 (94.21%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRAARKL 576
            VIA QD+ATYGGLCALASFDR+ELK KVIDN+NFRNFLELVP+VR LINDFYSSRYASCL+YL +LK+NLLLDIHLHDHV+TLYDQIR KALIQYT PFVSVDL  MA+AFKTSV+G+EKELEALITDNQIQARIDSHNKILYARHADQRNATFQ+VLQ G+EFD+DVR MLLRANLLKHEY+ R+ARKL
Sbjct:  252 VIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL 441          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_DICDI (COP9 signalosome complex subunit 1 OS=Dictyostelium discoideum GN=csn1 PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 5.219e-58
Identity = 109/189 (57.67%), Postives = 144/189 (76.19%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRAARK 573
            +I+ QD+A YGGLCALA+FDR ELK KVID+  F+N+LELVPE+R LINDFY+++Y SCL YL  +K  LLLDIHL+ HVE LY +IR+KAL+QY  P+ SVD+++MA+AF T+V  +EKE+  LI +N+IQARIDSHNK LYAR ADQR  TF++ +Q GS+F      +LLR  +L +  +  + RK
Sbjct:  240 IISPQDIAYYGGLCALATFDRNELKKKVIDDPMFKNYLELVPELRELINDFYNTKYGSCLKYLDKMKPILLLDIHLYKHVEILYQRIRSKALVQYFSPYQSVDMNIMASAFNTTVTLLEKEISKLIMENEIQARIDSHNKRLYARKADQRTTTFEKTVQVGSDFQNSSNSLLLRLEMLNNNISTVSNRK 428          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_DROME (COP9 signalosome complex subunit 1b OS=Drosophila melanogaster GN=CSN1b PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.124e-51
Identity = 99/186 (53.23%), Postives = 138/186 (74.19%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRA 564
            +I+  +VA YGGLCALA+FDR ELK  VI + +F+ FLEL P++R +I  FY S+YASCL  L  ++ NLL+D+++  HV TLY +IRN+ALIQY  P++S D+H MA AF +SV  +E E+  LI D QIQARIDSHNKIL+A+ ADQRN+TF+R L  G ++ +  R+++LRA +LK   +V++
Sbjct:  312 MISTSNVAVYGGLCALATFDRQELKRLVIASTSFKLFLELEPQLRDIIFKFYESKYASCLTLLDEIRDNLLVDMYIAPHVTTLYTKIRNRALIQYFSPYMSADMHKMAMAFNSSVGDLENEVMQLILDGQIQARIDSHNKILFAKEADQRNSTFERALIMGKQYQRHTRMLVLRAAMLKSHIHVKS 497          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_MOUSE (COP9 signalosome complex subunit 1 OS=Mus musculus GN=Gps1 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.774e-51
Identity = 101/186 (54.30%), Postives = 136/186 (73.12%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRA 564
            +++  +VA YGGLCALA+FDR EL+  VI + +F+ FLEL P+VR +I  FY S+YASCL  L  +K NLLLD++L  HV TLY QIRN+ALIQY  P+VS D+H MA AF T+VA +E EL  LI +  I ARIDSH+KILYAR  DQR+ TF++ L  G EF +  + M+LRA +L+++ +V++
Sbjct:  263 LLSPSNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHKMAAAFNTTVAALEDELTQLILEGLINARIDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMILRAAVLRNQIHVKS 448          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_XENLA (COP9 signalosome complex subunit 1 OS=Xenopus laevis GN=csn1 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.623e-51
Identity = 100/186 (53.76%), Postives = 137/186 (73.66%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRA 564
            +++  +VA YGGLCALA+FDR EL+  VI + +F+ FLEL P+VR +I  FY S+YASCL  L  +K NLLLD++L  HV TLY QIRN+ALIQY  P+VS D++ MA AF T+V+ +E EL  LI +  I ARIDSH+KILYAR  DQR+ TF++ LQ G EF +  + M+LRA +L+++ +V++
Sbjct:  279 LLSPSNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEIKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMYKMATAFNTTVSALEDELTQLILEGLINARIDSHSKILYARDVDQRSTTFEKSLQMGREFQRRAKAMILRAAVLRNQIHVKS 464          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_HUMAN (COP9 signalosome complex subunit 1 OS=Homo sapiens GN=GPS1 PE=1 SV=4)

HSP 1 Score: 201.06 bits (510), Expect = 4.731e-51
Identity = 100/186 (53.76%), Postives = 136/186 (73.12%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRA 564
            +++  +VA YGGLCALA+FDR EL+  VI + +F+ FLEL P+VR +I  FY S+YASCL  L  +K NLLLD++L  HV TLY QIRN+ALIQY  P+VS D+H MA AF T+VA +E EL  LI +  I AR+DSH+KILYAR  DQR+ TF++ L  G EF +  + M+LRA +L+++ +V++
Sbjct:  283 LLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKS 468          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_RAT (COP9 signalosome complex subunit 1 OS=Rattus norvegicus GN=Gps1 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.180e-51
Identity = 100/186 (53.76%), Postives = 136/186 (73.12%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRA 564
            +++  +VA YGGLCALA+FDR EL+  VI + +F+ FLEL P+VR +I  FY S+YASCL  L  +K NLLLD++L  HV TLY QIRN+ALIQY  P+VS D+H MA AF T+VA +E EL  +I +  I ARIDSH+KILYAR  DQR+ TF++ L  G EF +  + M+LRA +L+++ +V++
Sbjct:  263 LLSPSNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHKMAAAFNTTVAALEDELTQVILEGLINARIDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMILRAAVLRNQIHVKS 448          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_EMENI (COP9 signalosome complex subunit 1 OS=Emericella nidulans GN=csnA PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.608e-33
Identity = 79/196 (40.31%), Postives = 115/196 (58.67%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAF-----------KTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVR 561
            V+ + DVA YGGLCALAS DR EL+ +V+DN +FRNFLEL P +R  I+ F +S++  CL+ L   +A+ LLDIHL  HV+ LY++IR K++ QY  PF  V L  MA  F             S +   +EL +LI D  + ARID    +L +   D+R    + VL +   + ++  + LLR+N+++    VR
Sbjct:  271 VLTSNDVAVYGGLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADYLLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAFVQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNIIRAGLEVR 466          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_NEUCR (COP9 signalosome complex subunit 1 OS=Neurospora crassa GN=csn-1 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.090e-29
Identity = 70/189 (37.04%), Postives = 105/189 (55.56%), Query Frame = 1
Query:    7 VIAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANLLKHEYNVRAARK 573
            + +  DVA YGGL ALA+ DR EL++ ++DN +FR FL+  P +R  I  F + RYA+C++ L + + + LLDI+L  HV  LY  IR K+++QY  PF  V L  M  AF      IE EL  +I D ++ ARID+ NK               + LQT   +++     + R N++  +  V+ +RK
Sbjct:  231 IASPNDVAIYGGLLALATMDRHELQANLLDNDSFREFLQREPHIRRAITQFVNGRYAACIEILESYRPDYLLDIYLQKHVPKLYADIRTKSIVQYLKPFSCVRLDTMQKAFNGPGPSIEDELFTMIKDGKLNARIDAINK--------------SKALQTLENYEKQALDRIRRMNIMAADLEVKGSRK 405          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_CAEEL (COP9 signalosome complex subunit 1 OS=Caenorhabditis elegans GN=csn-1 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.368e-20
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 1
Query:   10 IAAQDVATYGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTGSEFDQDVRVMLLRANL 537
            + + D+  YG L A+A+  RA+LK +V  N  FR  LE  P++  L+  + SSR+  C + + ++K  LLLD  +  +V+ L+++IR K ++QY  P+ ++ +  MA A   S A ++  L  LI    +  +ID +  I+        NA  +RV  T     Q  + +L +  L
Sbjct:  353 VTSSDLGIYGMLSAMATMSRADLKLQVSGNGTFRKLLESEPQLIELLGSYTSSRFGRCFEIMRSVKPRLLLDPFISRNVDELFEKIRQKCVLQYLQPYSTIKMATMAEAVGMSSAELQLSLLELIEQKHVSLKIDQNEGIVRILDERDENAILKRVNVTCDRATQKAKSLLWKTTL 528          
The following BLAST results are available for this feature:
BLAST of CX308867 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
CSN1_ARATH8.820e-9085.79COP9 signalosome complex subunit 1 OS=Arabidopsis ... [more]
CSN1_DICDI5.219e-5857.67COP9 signalosome complex subunit 1 OS=Dictyosteliu... [more]
CSN1_DROME2.124e-5153.23COP9 signalosome complex subunit 1b OS=Drosophila ... [more]
CSN1_MOUSE2.774e-5154.30COP9 signalosome complex subunit 1 OS=Mus musculus... [more]
CSN1_XENLA3.623e-5153.76COP9 signalosome complex subunit 1 OS=Xenopus laev... [more]
CSN1_HUMAN4.731e-5153.76COP9 signalosome complex subunit 1 OS=Homo sapiens... [more]
CSN1_RAT6.180e-5153.76COP9 signalosome complex subunit 1 OS=Rattus norve... [more]
CSN1_EMENI2.608e-3340.31COP9 signalosome complex subunit 1 OS=Emericella n... [more]
CSN1_NEUCR5.090e-2937.04COP9 signalosome complex subunit 1 OS=Neurospora c... [more]
CSN1_CAEEL7.368e-2030.68COP9 signalosome complex subunit 1 OS=Caenorhabdit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21004G06Rv AbsLeaSub1 Citrus clementina cDNA clone C21004G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308867 ID=CX308867|Name=CX308867|organism=Citrus clementina|type=EST|length=689bp
GCGGGGGTGATTGCTGCTCAAGATGTTGCAACATACGGGGGACTTTGTGC
ACTTGCAAGTTTTGATCGGGCTGAGCTTAAGAGCAAAGTTATAGATAATG
TCAACTTCCGAAATTTCTTAGAGCTGGTTCCTGAAGTTAGGGTGCTTATT
AACGATTTCTACTCTAGCCGTTATGCATCATGTCTGGATTACCTTGGAAA
TCTTAAGGCAAACCTGTTGCTTGATATCCATTTGCACGACCATGTTGAGA
CGTTGTATGATCAAATACGTAACAAAGCCCTCATCCAGTATACACACCCA
TTTGTGTCTGTTGATTTGCACATGATGGCAAATGCTTTCAAAACAAGTGT
TGCTGGGATAGAGAAAGAGCTTGAAGCCTTGATTACTGACAACCAAATAC
AGGCTCGGATTGACTCACACAACAAGATTTTGTATGCACGACATGCGGAT
CAAAGAAATGCAACTTTCCAACGGGTTTTACAGACTGGCAGTGAATTTGA
TCAGGATGTGAGGGTAATGTTACTGAGGGCAAATCTTCTGAAGCATGAAT
ACAATGTTAGGGCTGCTAGGAAACTTTGAATAGGTAGATCTGCTTGCTTA
GATTCAATTTTACCTGCCGTTGTCTACTACTATTATTGAAGAAGAAGGGT
TCTACGTTATTTTGAAAGAAGATGGTTGTCCATGGTTGA
back to top