CX308869
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RD23D_ARATH (Putative DNA repair protein RAD23-4 OS=Arabidopsis thaliana GN=RAD23-4 PE=2 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 3.069e-13 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 2 Query: 41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145 MGFDRA+VLEVFFACNKNEELA NYLLDHMHEFED Sbjct: 343 MGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED 377
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RD23C_ARATH (Putative DNA repair protein RAD23-3 OS=Arabidopsis thaliana GN=RAD23-3 PE=2 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 1.523e-12 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 2 Query: 41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145 MGF+RALVLEVFFACNKNEELA NYLLDHMHEFE+ Sbjct: 385 MGFERALVLEVFFACNKNEELAANYLLDHMHEFEE 419
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RAD23_ORYSJ (Probable DNA repair protein RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 4.900e-11 Identity = 29/35 (82.86%), Postives = 34/35 (97.14%), Query Frame = 2 Query: 41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145 MGFDRALVL+VFFACNK+E+LA NYLLDHM+EF+D Sbjct: 354 MGFDRALVLDVFFACNKDEQLAANYLLDHMNEFDD 388 The following BLAST results are available for this feature:
BLAST of CX308869 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308869 ID=CX308869; Name=CX308869; organism=Citrus clementina; type=EST; length=480bpback to top |