CX309079

Overview
NameCX309079
Unique NameCX309079
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length620
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12979 contig Ccv1_Contig12979:927..1546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC1_DICDI (Serine hydroxymethyltransferase 1 OS=Dictyostelium discoideum GN=shmt1 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.142e-61
Identity = 120/202 (59.41%), Postives = 143/202 (70.79%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQ 607
            ANFAVYT LL P DRIMGLD PSGGHL+HGY T   KK+SA+SIFFES PY++    G IDY++LEE A+ ++PK++I G S+YPREWDY R R IADK GA LMCDMAH SGL+AA+ L SPFDYCD+VTSTTHK+L             K+         +G     YD E +INFAV PSLQGGPH N IA +A+ALK+
Sbjct:  107 ANFAVYTALLRPHDRIMGLDLPSGGHLTHGYQTDK-KKISASSIFFESMPYQIGAD-GLIDYQRLEENALLFKPKLIISGASAYPREWDYKRMRAIADKVGAYLMCDMAHYSGLVAAQLLDSPFDYCDVVTSTTHKTLRGPRSGIIFFRRGKRVD------GNGKEIEEYDIESKINFAVFPSLQGGPHENVIAGVAVALKE 300          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC2_DICDI (Serine hydroxymethyltransferase 2 OS=Dictyostelium discoideum GN=shmt2 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.104e-61
Identity = 118/206 (57.28%), Postives = 146/206 (70.87%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQVATP 619
            ANFA +TGLL P DRIMGLD PSGGHL+HGY T   KK+SA SIFFES PY+VN +TGY+DY K+E  A  +RPK+LI G S+YPREWDY R R+IADK GA L+CDMAHISG++A K+  SPF +CD+VT+TTHK+L             K+   +G  ++        D E RINFAV PS QGGPH N IA +A+ALK+ ++P
Sbjct:  131 ANFAAFTGLLKPHDRIMGLDLPSGGHLTHGYQTDK-KKISATSIFFESMPYQVN-ETGYVDYNKMEANAALFRPKLLIAGASAYPREWDYERMRKIADKHGAYLLCDMAHISGMVAGKQAISPFLFCDVVTTTTHKTLRGPRAGLIFFRKTKRRDAKGNIIDD-------DLENRINFAVFPSCQGGPHENTIAGIAVALKEASSP 327          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYM_PEA (Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.856e-56
Identity = 112/207 (54.11%), Postives = 141/207 (68.12%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSL-XXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQVATP 619
            +NF VYT LL P DRIM LD P GGHLSHGY T   KK+SA SIFFE+ PY+++  TGYIDY++LE+ A  +RPK+++ G S+Y R +DY R R++ DK  AVL+ DMAHISGL+AA  + SPFDY D+VT+TTHKSL              K+  KQG  +        YD+E++IN AV P LQGGPHN+ I  LA+ALKQ  TP
Sbjct:  153 SNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDT-KKISAVSIFFETMPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEV-------FYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP 351          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC_CANGA (Serine hydroxymethyltransferase, cytosolic OS=Candida glabrata GN=SHM2 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.856e-56
Identity = 119/214 (55.61%), Postives = 140/214 (65.42%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSN--------YDFEERINFAVHPSLQGGPHNNHIAALAIALKQVATP 619
            AN  VY  L+ P +R+MGL  P GGHLSHGY T   +K+SA S +FESFPY+VNP+TG IDY+ LE+ A+ YRPKIL+ G S+Y R  DY R R+IADKCGA LM DMAHISGL+AA  + SPF+Y DIVT+TTHKSL             + PR   I    G    N        YD E  INF+V P  QGGPHN+ IAALA ALKQ ATP
Sbjct:  114 ANLQVYQALMKPHERLMGLYLPDGGHLSHGYATEN-RKISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLVAAGVIPSPFEYADIVTTTTHKSL-------------RGPRGAMIFFRRGIRSVNQKTGKEIPYDLENPINFSVFPGHQGGPHNHTIAALATALKQAATP 313          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC_YEAST (Serine hydroxymethyltransferase, cytosolic OS=Saccharomyces cerevisiae GN=SHM2 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 1.511e-55
Identity = 118/214 (55.14%), Postives = 140/214 (65.42%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSN--------YDFEERINFAVHPSLQGGPHNNHIAALAIALKQVATP 619
            AN  VY  ++ P +R+MGL  P GGHLSHGY T   +K+SA S +FESFPY+VNP+TG IDY+ LE+ A+ YRPK+L+ G S+Y R  DY R R+IADKCGA LM DMAHISGLIAA  + SPF+Y DIVT+TTHKSL             + PR   I    G    N        YD E  INF+V P  QGGPHN+ IAALA ALKQ ATP
Sbjct:  114 ANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATEN-RKISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL-------------RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTIAALATALKQAATP 313          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC_CAEBR (Serine hydroxymethyltransferase OS=Caenorhabditis briggsae GN=mel-32 PE=3 SV=3)

HSP 1 Score: 214.542 bits (545), Expect = 3.365e-55
Identity = 115/203 (56.65%), Postives = 139/203 (68.47%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSN-YDFEERINFAVHPSLQGGPHNNHIAALAIALKQ 607
            ANFAVYT L+    RIMGLD P GGHL+HG+ TP  +KVSA S FF+S PYKV+ Q+G IDY+KLEE AM +RPK+LI G S Y R  DY RFR+IA K GA LM DMAHISGL+AA  + SPF+Y D+VT+TTHKSL                 ++G+   +  G    YD EE+IN AV P LQGGPHN+ IA +A+ALKQ
Sbjct:  153 ANFAVYTALVGANGRIMGLDLPDGGHLTHGFFTPA-RKVSATSEFFQSMPYKVDAQSGLIDYDKLEENAMLFRPKVLIAGVSCYARHLDYERFRKIATKAGAYLMSDMAHISGLVAAGLIPSPFEYSDVVTTTTHKSLRGPRGAMIFY-------RKGVRSVNAKGVETLYDLEEKINSAVFPGLQGGPHNHTIAGIAVALKQ 347          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYM_SOLTU (Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 7.497e-55
Identity = 110/207 (53.14%), Postives = 141/207 (68.12%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSL-XXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQVATP 619
            ANF VYT LL P +RIM LD P GGHLSHGY T   KK+SA SIFFE+ PY+++  TGYIDY++LE+ A  +RPK+++ G S+Y R +DY R R++ +K  A+L+ DMAHISGL+AA  + SPFDY D+VT+TTHKSL              K+  KQG  +        YD+E++IN AV P LQGGPHN+ I  LA+ALKQ  TP
Sbjct:  153 ANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDT-KKISAVSIFFETMPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEV-------FYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP 351          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYN_FLAPR (Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 9.791e-55
Identity = 111/206 (53.88%), Postives = 139/206 (67.48%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSL-XXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQVAT 616
            ANF VYT LL   DRIM LD P GGHLSHGY T   KK+SA SIFFE+ PY++N  TGYIDY++LE+ A  +RPK+++ G S+Y R +DY R R++ DK  A+L+ DMAHISGL+AA  + SPFDY D+VT+TTHKSL              K+  KQG  +        YD+E++IN AV P LQGGPHN+ I  LA+ALKQ  T
Sbjct:  153 ANFHVYTALLKAHDRIMALDLPHGGHLSHGYQTDT-KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQGKEV-------LYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT 350          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYC_CAEEL (Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 1.279e-54
Identity = 112/203 (55.17%), Postives = 138/203 (67.98%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSLXXXXXXXXXXXXXKKPRKQGIPLNHGDGCSN-YDFEERINFAVHPSLQGGPHNNHIAALAIALKQ 607
            ANFAVYT ++    RIMGLD P GGHL+HG+ TP  +KVSA S FF+S PYKV+P TG IDY+KLE+ AM +RPK +I G S Y R  DY RFR+IA K GA LM DMAHISGL+AA  + SPF+Y D+VT+TTHKSL                 ++G+   +  G    YD EE+IN AV P LQGGPHN+ IA +A+AL+Q
Sbjct:  149 ANFAVYTAIVGSNGRIMGLDLPDGGHLTHGFFTPA-RKVSATSEFFQSLPYKVDPTTGLIDYDKLEQNAMLFRPKAIIAGVSCYARHLDYERFRKIATKAGAYLMSDMAHISGLVAAGLIPSPFEYSDVVTTTTHKSLRGPRGALIFY-------RKGVRSTNAKGVDTLYDLEEKINSAVFPGLQGGPHNHTIAGIAVALRQ 343          
BLAST of CX309079 vs. ExPASy Swiss-Prot
Match: GLYM_FLAPR (Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.670e-54
Identity = 110/206 (53.40%), Postives = 139/206 (67.48%), Query Frame = 2
Query:    2 ANFAVYTGLLLPGDRIMGLDSPSGGHLSHGYHTPGGKKVSAASIFFESFPYKVNPQTGYIDYEKLEEKAMDYRPKILICGGSSYPREWDYGRFRQIADKCGAVLMCDMAHISGLIAAKELASPFDYCDIVTSTTHKSL-XXXXXXXXXXXXXKKPRKQGIPLNHGDGCSNYDFEERINFAVHPSLQGGPHNNHIAALAIALKQVAT 616
            ANF VYT LL   DRIM LD P GGHLSHGY T   KK+SA SIFFE+ PY++N  TGYIDY++LE+ A  +RPK+++ G S+Y R +DY R R++ DK  A+++ DMAHISGL+AA  + SPFDY D+VT+TTHKSL              K+  KQG  +        YD+E++IN AV P LQGGPHN+ I  LA+ALKQ  T
Sbjct:  153 ANFHVYTALLKAHDRIMALDLPHGGHLSHGYQTDT-KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEV-------FYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT 350          
The following BLAST results are available for this feature:
BLAST of CX309079 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GLYC1_DICDI3.142e-6159.41Serine hydroxymethyltransferase 1 OS=Dictyostelium... [more]
GLYC2_DICDI4.104e-6157.28Serine hydroxymethyltransferase 2 OS=Dictyostelium... [more]
GLYM_PEA8.856e-5654.11Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYC_CANGA8.856e-5655.61Serine hydroxymethyltransferase, cytosolic OS=Cand... [more]
GLYC_YEAST1.511e-5555.14Serine hydroxymethyltransferase, cytosolic OS=Sacc... [more]
GLYC_CAEBR3.365e-5556.65Serine hydroxymethyltransferase OS=Caenorhabditis ... [more]
GLYM_SOLTU7.497e-5553.14Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYN_FLAPR9.791e-5553.88Serine hydroxymethyltransferase 2, mitochondrial O... [more]
GLYC_CAEEL1.279e-5455.17Serine hydroxymethyltransferase OS=Caenorhabditis ... [more]
GLYM_FLAPR1.670e-5453.40Serine hydroxymethyltransferase 1, mitochondrial O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008C07Rv AbsLeaSub1 Citrus clementina cDNA clone C21008C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309079 ID=CX309079|Name=CX309079|organism=Citrus clementina|type=EST|length=620bp
TGCAAATTTCGCGGTCTATACGGGTCTTTTGTTGCCTGGGGATAGAATTA
TGGGGTTAGATTCTCCTTCTGGAGGGCATTTGAGTCACGGCTACCATACA
CCAGGAGGGAAGAAGGTTTCAGCTGCTTCAATATTCTTTGAGAGTTTTCC
TTATAAAGTGAATCCGCAAACTGGCTATATTGATTACGAAAAGCTGGAGG
AGAAGGCCATGGATTATAGACCCAAGATTTTGATTTGTGGTGGGAGTTCA
TATCCCAGAGAGTGGGATTATGGGAGGTTTAGGCAGATTGCAGATAAGTG
TGGTGCAGTTTTGATGTGTGATATGGCTCATATTAGTGGGCTCATTGCTG
CTAAGGAATTGGCCAGTCCATTTGATTATTGTGATATCGTGACTTCAACA
ACTCACAAAAGTTTACGAGGTCCTAGGGGAGGGATCATTTTCTTTAGGAG
AGGCAAAAAACCAAGGAAGCAAGGCATACCCCTCAATCATGGTGATGGTT
GTAGTAATTATGATTTCGAGGAGAGGATAAACTTTGCTGTCCATCCATCA
CTACAAGGGGGTCCTCACAATAATCACATTGCTGCTCTTGCCATAGCATT
GAAACAAGTGGCAACTCCTG
back to top