CX309086

Overview
NameCX309086
Unique NameCX309086
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length441
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig976 contig Ccv1_Contig976:1..448. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309086 vs. ExPASy Swiss-Prot
Match: CHMU_ARATH (Chorismate mutase, chloroplastic OS=Arabidopsis thaliana GN=CM1 PE=2 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.126e-18
Identity = 43/80 (53.75%), Postives = 61/80 (76.25%), Query Frame = -1
Query:   10 LTLDLVRDSLIRQEDTIIFCLIERAKHPLNAPAYDQSYASFPGFSGSLLQYIVQQSEAMQATAGRYENPEESPFFPDKLP 249
            LTL+ +R+SLIRQED+IIF L+ERAK+  NA  YD +     GF+GSL++Y+V+ +E + A  GR+++P+E PFFPD LP
Sbjct:   80 LTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLP 159          
BLAST of CX309086 vs. ExPASy Swiss-Prot
Match: CHMU_YEAST (Chorismate mutase OS=Saccharomyces cerevisiae GN=ARO7 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 6.617e-11
Identity = 33/85 (38.82%), Postives = 48/85 (56.47%), Query Frame = -1
Query:    1 LTLDLVRDSLIRQEDTIIFCLIERAKHPLNAPAYDQSYASF--PGFSGSLLQYIVQQSEAMQATAGRYENPEESPFFPDKLPHSF 249
            L L  +RD L+R ED+IIF  IER+        Y+ ++     P F GS L + +   E   +   R+E+P+E+PFFPDK+  SF
Sbjct:   10 LNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSF 94          
The following BLAST results are available for this feature:
BLAST of CX309086 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CHMU_ARATH1.126e-1853.75Chorismate mutase, chloroplastic OS=Arabidopsis th... [more]
CHMU_YEAST6.617e-1138.82Chorismate mutase OS=Saccharomyces cerevisiae GN=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21008D03Rv AbsLeaSub1 Citrus clementina cDNA clone C21008D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309086 ID=CX309086|Name=CX309086|organism=Citrus clementina|type=EST|length=441bp
AAATGAATGCGGCAGTTTATCAGGGAAGAAGGGACTTTCTTCTGGATTCT
CATATCTCCCAGCTGTGGCTTGCATGGCCTCTGATTGTTGAACAATGTAT
TGAAGCAAAGAACCAGAGAAGCCAGGAAATGAAGCATAAGACTGATCATA
AGCTGGAGCATTAAGAGGGTGCTTAGCTCTCTCAATGAGACAGAATATAA
TGGTATCTTCTTGCCTAATCAATGAGTCCCTCACCAAGTCAAGCGTTAAA
TCCCCTGCCAATGCCATCTTGTTCTCTACTACAAGGACTACAACTATCAA
CACAACCAAAAACATTCTCAATGCAAAACAGAGAATCCTCAATAAACAAA
ATGAGAAAATAAACACAAATGAAAAATAGATTCTTAGTAATCGTTACCAA
ATCTTTTCTTAATTAAGAAGAGATATTTCTTCCTCTCCCCG
back to top