CX309088

Overview
NameCX309088
Unique NameCX309088
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX309088 vs. ExPASy Swiss-Prot
Match: RL34_TOBAC (60S ribosomal protein L34 OS=Nicotiana tabacum GN=RPL34 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.327e-27
Identity = 59/62 (95.16%), Postives = 60/62 (96.77%), Query Frame = 3
Query:    3 STKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF 188
            STKKRASGPKCPVTGKRIQGIPHLRP EYKRSRL RNRRTVNRAYGGVLSG+AVRERIIRAF
Sbjct:   34 STKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CX309088 vs. ExPASy Swiss-Prot
Match: RL341_ARATH (60S ribosomal protein L34-1 OS=Arabidopsis thaliana GN=RPL34A PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.264e-27
Identity = 58/62 (93.55%), Postives = 61/62 (98.39%), Query Frame = 3
Query:    3 STKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF 188
            +TKKRASGPKCPVTGKRIQGIPHLRP+EYKRSRL RNRRTVNRAYGGVLSG+AVRERIIRAF
Sbjct:   34 TTKKRASGPKCPVTGKRIQGIPHLRPSEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CX309088 vs. ExPASy Swiss-Prot
Match: RL342_ARATH (60S ribosomal protein L34-2 OS=Arabidopsis thaliana GN=RPL34B PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.957e-27
Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 3
Query:    3 STKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF 188
            +TKKRASGPKCPVTGKRIQGIPHLRP EYKRSRL RNRRTVNRAYGGVLSG+AVRERIIRAF
Sbjct:   34 TTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CX309088 vs. ExPASy Swiss-Prot
Match: RL34_PEA (60S ribosomal protein L34 OS=Pisum sativum GN=RPL34 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.862e-27
Identity = 58/62 (93.55%), Postives = 59/62 (95.16%), Query Frame = 3
Query:    3 STKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF 188
            +TKKRASGPKCPVTGKRIQGIPHLRP EYKRSRL RNRRTVNRAYGGVLSG AVRERIIRAF
Sbjct:   34 TTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF 95          
BLAST of CX309088 vs. ExPASy Swiss-Prot
Match: RL343_ARATH (60S ribosomal protein L34-3 OS=Arabidopsis thaliana GN=RPL34C PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.503e-26
Identity = 56/62 (90.32%), Postives = 58/62 (93.55%), Query Frame = 3
Query:    3 STKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF 188
            +T KRASGPKCPVTGKRIQGIPHLRPAEYKRSRL RN RTVNRAYGGVLSG AVRERI+RAF
Sbjct:   34 TTNKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAF 95          
The following BLAST results are available for this feature:
BLAST of CX309088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
RL34_TOBAC1.327e-2795.1660S ribosomal protein L34 OS=Nicotiana tabacum GN=... [more]
RL341_ARATH2.264e-2793.5560S ribosomal protein L34-1 OS=Arabidopsis thalian... [more]
RL342_ARATH2.957e-2793.5560S ribosomal protein L34-2 OS=Arabidopsis thalian... [more]
RL34_PEA3.862e-2793.5560S ribosomal protein L34 OS=Pisum sativum GN=RPL3... [more]
RL343_ARATH2.503e-2690.3260S ribosomal protein L34-3 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21008D06Rv AbsLeaSub1 Citrus clementina cDNA clone C21008D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309088 ID=CX309088|Name=CX309088|organism=Citrus clementina|type=EST|length=445bp
AGAGCACGAAGAAAAGAGCTAGTGGACCTAAGTGTCCTGTGACTGGCAAG
AGAATTCAAGGGATTCCTCATTTGAGACCTGCTGAATATAAGAGGTCCAG
ATTGCCCAGAAACAGGAGGACTGTGAACCGTGCTTATGGTGGAGTATTGT
CTGGAGCTGCTGTCAGGGAAAGAATCATCCGTGCCTTTTTGGTGGAAGAG
CAGAAGATTGTGAAGAAGGTCTTGAAGATTCAGAAGGCAAAAGAGAAGCA
AGCTGCTAAGAGTTAAGACTGAAATATTTAATGAGTTTCGAACTACCTTT
TAGAATATCTGTTGTTTTGGATGATGATATTGACTCATGGAGAAGTAATC
TAGGTTTTTCTTTATTTGAAATTGTAATCCCGCACTTGCTCATATGAACT
AAATTCTTAAAGCACTCAGTTGATAACCATTGTGGTGCTGTTTTG
back to top