CX309092

Overview
NameCX309092
Unique NameCX309092
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length318
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1683 contig Ccv1_Contig1683:265..582. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH23_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.045e-53
Identity = 94/106 (88.68%), Postives = 100/106 (94.34%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            FGKIDMQ+KLV GNSAGTVTAYYLKSPGSTWDEIDFEFL NLSGDPYTLHTNVFT GKGDREQQF LWFDPT+DFHTYS+LWNPQRI+F VDG+PIREFKN+ES G
Sbjct:   68 FGKIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQG 173          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH25_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 1.241e-50
Identity = 90/106 (84.91%), Postives = 95/106 (89.62%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            FGKIDMQLKLVPGNSAGTVTAYYLKS G TWDEIDFEFL NL+GDPYT+HTNV+T GKGDREQQFHLWFDPTADFHTYSVLWNP  IVF VD  P+REFKNL+  G
Sbjct:   72 FGKIDMQLKLVPGNSAGTVTAYYLKSKGDTWDEIDFEFLGNLTGDPYTMHTNVYTQGKGDREQQFHLWFDPTADFHTYSVLWNPHHIVFMVDDIPVREFKNLQHMG 177          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH24_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 24 OS=Arabidopsis thaliana GN=XTH24 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 3.610e-50
Identity = 88/106 (83.02%), Postives = 97/106 (91.51%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            FGKIDMQ+KLVPGNSAGTVT +YLKS GSTWDEIDFEFL N+SGDPYTLHTNV+T GKGD+EQQFHLWFDPTA+FHTYS+LWNPQRI+  VD +PIREFKN ES G
Sbjct:   66 FGKIDMQIKLVPGNSAGTVTTFYLKSEGSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFHTYSILWNPQRIILTVDDTPIREFKNYESLG 171          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH22_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.213e-49
Identity = 85/106 (80.19%), Postives = 97/106 (91.51%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            FGK+ MQ+KLVPGNSAGTVT  YLKSPG+TWDEIDFEFL N SG+PYTLHTNV+T GKGD+EQQF LWFDPTA+FHTY++LWNPQRI+F VDG+PIREFKN+ES G
Sbjct:   65 FGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLG 170          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH21_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana GN=XTH21 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.830e-48
Identity = 83/106 (78.30%), Postives = 93/106 (87.74%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            +GK+DMQ+KLVPGNSAGTVT +YLKS G TWDEIDFEFL N+SGDPY +HTNV+T GKGDREQQF+LWFDPTA FH YS+LWNP  IVFY+DG PIREFKNLE  G
Sbjct:   70 YGKVDMQIKLVPGNSAGTVTTFYLKSQGLTWDEIDFEFLGNVSGDPYIVHTNVYTQGKGDREQQFYLWFDPTAAFHNYSILWNPSHIVFYIDGKPIREFKNLEVLG 175          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH20_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana GN=XTH20 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.284e-47
Identity = 79/106 (74.53%), Postives = 95/106 (89.62%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            +GK+++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFL N+SG PYTLHTNV+T G GD+EQQFHLWFDPT DFHTY ++WNPQR++F +DG PIREFKN E+ G
Sbjct:   72 YGKVEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVDFHTYCIIWNPQRVIFTIDGIPIREFKNSEALG 177          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH19_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.736e-47
Identity = 81/106 (76.42%), Postives = 93/106 (87.74%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            +GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFL N+SG PYTLHTNV+T G GD+EQQFHLWFDPTA+FHTY + WNPQRI+F VDG PIREF N ES G
Sbjct:   67 YGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGSGDKEQQFHLWFDPTANFHTYCITWNPQRIIFTVDGIPIREFMNAESRG 172          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH18_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 18 OS=Arabidopsis thaliana GN=XTH18 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.736e-47
Identity = 82/106 (77.36%), Postives = 93/106 (87.74%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            +GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFL NLSG PYTLHTNV+T G GD+EQQFHLWFDPT +FHTY + WNPQRI+F VDG PIREFKN ES G
Sbjct:   72 YGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNLSGHPYTLHTNVYTKGSGDKEQQFHLWFDPTVNFHTYCITWNPQRIIFTVDGIPIREFKNSESIG 177          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH17_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 17 OS=Arabidopsis thaliana GN=XTH17 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.421e-46
Identity = 80/106 (75.47%), Postives = 93/106 (87.74%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            +GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFL N+SG PYTLHTNV+T G GD+EQQFHLWFDPT +FHTY + WNPQRI+F VDG PIREFKN E+ G
Sbjct:   72 YGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVNFHTYCITWNPQRIIFTVDGIPIREFKNPEAIG 177          
BLAST of CX309092 vs. ExPASy Swiss-Prot
Match: XTH12_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.421e-46
Identity = 82/106 (77.36%), Postives = 92/106 (86.79%), Query Frame = -1
Query:    1 FGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLENLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNG 318
            FGKIDM++KLVPGNSAGTVTAYYL S G TWDEIDFEFL N++G PY +HTNVFT GKG+RE QF+LWFDPTADFHTY+VLWNP  I+F VDG PIR FKN E+NG
Sbjct:   69 FGKIDMKIKLVPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANG 174          
The following BLAST results are available for this feature:
BLAST of CX309092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
XTH23_ARATH2.045e-5388.68Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH25_ARATH1.241e-5084.91Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH24_ARATH3.610e-5083.02Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH22_ARATH5.213e-4980.19Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH21_ARATH9.830e-4878.30Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH20_ARATH1.284e-4774.53Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH19_ARATH3.736e-4776.42Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH18_ARATH3.736e-4777.36Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH17_ARATH2.421e-4675.47Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH12_ARATH2.421e-4677.36Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008D11Rv AbsLeaSub1 Citrus clementina cDNA clone C21008D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309092 ID=CX309092|Name=CX309092|organism=Citrus clementina|type=EST|length=318bp
GCCGTTTGATTCCAAGTTCTTGAACTCTCTAATTGGCGAGCCATCAACAT
AGAAGACAATACGTTGGGGATTCCAGAGAACGGAATAGGTGTGAAAGTCA
GCAGTGGGGTCAAACCAGAGGTGGAATTGTTGCTCTCTGTCACCTTTGCC
ATTTGTGAACACATTAGTATGAAGAGTATAAGGATCACCACTTAAATTCT
CCAAGAATTCGAAGTCTATCTCATCCCATGTTGATCCTGGTGATTTTAAG
TAGTAGGCGGTGACTGTGCCGGCAGAATTGCCAGGGACAAGCTTGAGTTG
CATGTCGATTTTGCCAAA
back to top