DY257711

Overview
NameDY257711
Unique NameDY257711
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig851 contig Ccv1_Contig851:81..525. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: WIN1_SOLTU (Wound-induced protein WIN1 OS=Solanum tuberosum GN=WIN1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.564e-36
Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGPVGPRG+ +CGKCLRVTN  TGAQ TVRIVDQCSNGGLDLDV VFR++DTDG GN QGHL+VNYQFV+CGD
Sbjct:  120 KYGWTAFCGPVGPRGRDSCGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHLIVNYQFVDCGD 199          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.043e-36
Identity = 66/80 (82.50%), Postives = 73/80 (91.25%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGPVGPRG+ +CGKCLRVTN  TGAQ TVRIVDQCSNGGLDLD+ VF+++DTDG GN QGHL+VNYQFVNCGD
Sbjct:  119 KYGWTAFCGPVGPRGRDSCGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHLIVNYQFVNCGD 198          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: WIN_SOYBN (Wound-induced protein (Fragment) OS=Glycine max GN=WIN PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.950e-35
Identity = 64/80 (80.00%), Postives = 72/80 (90.00%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGPVGPRG+ +CGKCLRVTN GTGA   VRIVDQCSNGGLDLDVGVF ++DTDG+G  QGHL+VNYQFV+CG+
Sbjct:    8 KYGWTAFCGPVGPRGRDSCGKCLRVTNTGTGANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHLIVNYQFVDCGN 87          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: PR4_PRUPE (Pathogenesis-related protein PR-4 (Fragment) OS=Prunus persica PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 5.032e-35
Identity = 64/80 (80.00%), Postives = 72/80 (90.00%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGPVGP GQ +CGKCL VTN GTGA+ TVRIVDQCSNGGLDLDV VF ++DT+G+GNAQGHL+VNY FV+CGD
Sbjct:   28 KYGWTAFCGPVGPTGQDSCGKCLLVTNTGTGAKVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGNAQGHLIVNYDFVDCGD 107          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.121e-34
Identity = 64/80 (80.00%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGP GPRGQ +CG+CLRVTN GTG QATVRIVDQCSNGGLDLDV VF +LDT+G G  QGHL+VNY+FVNC D
Sbjct:   68 KYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 1.121e-34
Identity = 64/80 (80.00%), Postives = 71/80 (88.75%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGPVG  GQ++CGKCL VTN GTGA+ TVRIVDQCSNGGLDLDV VFR+LDTDGKG  +GH+ VNYQFV+CGD
Sbjct:  110 KYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGD 189          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.563e-34
Identity = 63/80 (78.75%), Postives = 68/80 (85.00%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGP GPRGQ +CG+CLRVTN GTG Q TVRIVDQCSNGGLDLDV VF +LDT+G G  QGHL VNY+FVNC D
Sbjct:   68 KYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: HEVL_ARATH (Hevein-like protein OS=Arabidopsis thaliana GN=HEL PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 6.800e-32
Identity = 60/80 (75.00%), Postives = 68/80 (85.00%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGP GPRGQA+CGKCLRV N  T A  TVRIVDQCSNGGLDLDV +F ++DTDG G  QGHL+V+YQFV+CG+
Sbjct:  114 KYGWTAFCGPAGPRGQASCGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGN 193          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 3.375e-31
Identity = 63/81 (77.78%), Postives = 67/81 (82.72%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVG-VFRKLDTDGKGNAQGHLMVNYQFVNCGD 242
            KYGWTAFCGP GPRGQAACGKCLRVTN  TGAQ T RIVDQC+NGGLDLD   VF K+DT+G G  QGHL VNYQFV+C D
Sbjct:   45 KYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 125          
BLAST of DY257711 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 5.757e-31
Identity = 58/78 (74.36%), Postives = 66/78 (84.62%), Query Frame = 3
Query:    3 KYGWTAFCGPVGPRGQAACGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHLMVNYQFVNC 236
            +YGWTAFCGP GP GQA+CG+CLRVTN GTG Q TVRIVDQC NGGLDLDV VF +LDT+G G  +G+L VNY+FVNC
Sbjct:   66 RYGWTAFCGPAGPTGQASCGRCLRVTNTGTGTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC 143          
The following BLAST results are available for this feature:
BLAST of DY257711 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
WIN1_SOLTU1.564e-3683.75Wound-induced protein WIN1 OS=Solanum tuberosum GN... [more]
WIN2_SOLTU2.043e-3682.50Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
WIN_SOYBN2.950e-3580.00Wound-induced protein (Fragment) OS=Glycine max GN... [more]
PR4_PRUPE5.032e-3580.00Pathogenesis-related protein PR-4 (Fragment) OS=Pr... [more]
PR4B_TOBAC1.121e-3480.00Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
HEVE_HEVBR1.121e-3480.00Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]
PR4A_TOBAC5.563e-3478.75Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
HEVL_ARATH6.800e-3275.00Hevein-like protein OS=Arabidopsis thaliana GN=HEL... [more]
BARW_HORVU3.375e-3177.78Barwin OS=Hordeum vulgare PE=1 SV=1[more]
PRP2_SOLLC5.757e-3174.36Pathogenesis-related protein P2 OS=Solanum lycoper... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AA11ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257711 ID=DY257711|Name=DY257711|organism=Citrus clementina|type=EST|length=445bp
GGAAGTATGGATGGACTGCCTTCTGTGGCCCTGTTGGACCTCGTGGACAA
GCTGCTTGTGGCAAGTGCTTAAGGGTGACTAATAGAGGGACAGGAGCTCA
AGCAACGGTGAGAATTGTTGATCAGTGCAGCAATGGCGGTCTAGATTTGG
ATGTCGGTGTTTTCCGGAAGCTGGATACTGATGGAAAAGGCAATGCTCAA
GGTCACCTCATGGTGAATTACCAGTTTGTTAACTGCGGAGATTGAAACAT
TTGAATATTAAAAAAAAAAAAAAAAAACCAACATAATAAGAATAATAATT
ATGGTGTGTTGATCATATATAAATCAACCTTATGATTATAGAATAAAAAT
TCACAATAATTTGTGATCATGAATGTATTGTTCATGCAAAGACTGCGTGC
ATGGACCTTTAATTACAGTGTAGTTCTCTACTAAAGTCCTTCTGC
back to top