DY257712

Overview
NameDY257712
Unique NameDY257712
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1181
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9885 contig Ccv1_Contig9885:4..1185. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC2_SOLTU (Mitochondrial outer membrane protein porin of 36 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 415.231 bits (1066), Expect = 2.261e-118
Identity = 206/256 (80.47%), Postives = 230/256 (89.84%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS-FLLSQE 852
            MVKGPGLYS+IGKKARDLLY+DY SDHKFTVTTY++ GVAIT+SG+KKGELFLADVSTQLKNKNITTDVKVDTNSN++TTITVDEPAPGLK+IFSF+VPDQ+SGKVELQY HEYAGI+T IG TA+P+            ALGTDLSFDTATGNFTKC+AGLS++  DLIASL LNDKGDT++ASYYH V P+TNTAVGAELTHSFSSNENTLTIGTQH LDPLT+VKARVN+YG+ASALIQHEWRPKS F +S E
Sbjct:    1 MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQLKNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSNENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGE 256          

HSP 2 Score: 33.113 bits (74), Expect = 2.261e-118
Identity = 17/26 (65.38%), Postives = 18/26 (69.23%), Query Frame = 3
Query:  837 FTISGEGKPRAIEKREKIGLGLPPKP 914
            FTISGE   RAIEK  KIGL +  KP
Sbjct:  251 FTISGEVDTRAIEKSAKIGLAVALKP 276          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC1_SOLTU (Mitochondrial outer membrane protein porin of 34 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 390.193 bits (1001), Expect = 2.328e-109
Identity = 190/256 (74.22%), Postives = 220/256 (85.94%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS-FLLSQE 852
            M KGPGLY+EIGKKARDLLYKDYQSDHKF++TTY+  GV ITSSG KKG+LFLADV+TQLKNKN+TTD+KVDTNSNLFTTITVDE APGLK+I SF VPDQRSGK+E+QY H+YAGI T +G TANPI            ALGTD+SFDT TG+FTKC+AGLS+T+ DL+ASL LN+KGD L ASYYH VSPLT+TAVGAE+ HSFS+NEN +T+GTQH LDPLTSVKAR+NN+G+ASAL+QHEWRPKS F +S E
Sbjct:    1 MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQLKNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHTVSPLTSTAVGAEVNHSFSTNENIITVGTQHRLDPLTSVKARINNFGKASALLQHEWRPKSLFTVSGE 256          

HSP 2 Score: 28.1054 bits (61), Expect = 2.328e-109
Identity = 12/26 (46.15%), Postives = 17/26 (65.38%), Query Frame = 3
Query:  837 FTISGEGKPRAIEKREKIGLGLPPKP 914
            FT+SGE   ++++K  K GL L  KP
Sbjct:  251 FTVSGEVDTKSVDKGAKFGLALALKP 276          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC_PEA (Outer plastidial membrane protein porin OS=Pisum sativum GN=POR1 PE=1 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 9.004e-100
Identity = 173/251 (68.92%), Postives = 204/251 (81.27%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSFL 840
            MVKGPGLY++IGKKARDLLYKDY SD KFT++TY+  GVAITSSG KKGELFL DV+TQLKNKNITTD+KVDTNSNLFTTITV+EPAPG+K+I SF VP+Q SGKVELQY HEYAGIS+ +G  ANPI            A G D+SFDT  G  TK +A +++   DLI SLTLN+KGD L+ASYYH ++PL+NTAVG +++H FS+ ENT T+GTQHALDPLT+VK RV N G+ASALIQHEWRPKS +
Sbjct:    1 MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQLKNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTKENTFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLI 251          

HSP 2 Score: 28.4906 bits (62), Expect = 9.004e-100
Identity = 15/25 (60.00%), Postives = 16/25 (64.00%), Query Frame = 3
Query:  840 TISGEGKPRAIEKREKIGLGLPPKP 914
            TIS E   +AIEK  KIGL L  KP
Sbjct:  252 TISSEVDTKAIEKSAKIGLSLALKP 276          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC1_ARATH (Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana GN=At3g01280 PE=1 SV=3)

HSP 1 Score: 350.132 bits (897), Expect = 9.859e-99
Identity = 174/250 (69.60%), Postives = 204/250 (81.60%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSF 837
            MVKGPGLY+EIGKKARDLLYKD+ SD KF++TT++ AGVAITS+G KKG+L L DV+ Q + KNITTD+KV T+S    T TVDE APGL+SIFSF VPDQ SGKVELQY HEYAGIST +G T NP             A+GTD+SFDT +GNFTK +AGLS+T  DLIASLT+NDKGD LNASYYHIV+PL NTAVGAE++H  SS ++T+T+GTQH+LDPLTSVKARVN+ G ASALIQHEW+PKSF
Sbjct:    1 MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSF 250          

HSP 2 Score: 32.7278 bits (73), Expect = 9.859e-99
Identity = 15/27 (55.56%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  834 FFTISGEGKPRAIEKREKIGLGLPPKP 914
            FFTISGE   ++I+K  K+GL L  KP
Sbjct:  250 FFTISGEVDTKSIDKSAKVGLALALKP 276          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC1_ORYSJ (Mitochondrial outer membrane protein porin OS=Oryza sativa subsp. japonica GN=VDAC1 PE=1 SV=3)

HSP 1 Score: 337.035 bits (863), Expect = 9.967e-93
Identity = 166/246 (67.48%), Postives = 198/246 (80.49%), Query Frame = 1
Query:   97 GPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS 834
            GPGLY EIGKKARDLLY+DYQ+DHKFT+TTYTS GVAIT++  KK +L   ++ +Q+KNKNIT DVK +++SN+ TT+TVDE  PGLKSI SF VPDQRSGK ELQY H+YAG+S  IG TA+P+            A+G D+S DTATGN TK +AGLS+++ DLIASL LN+KGD+L ASYYHIV+  + TAVGAELTHSFSSNEN+LT GTQH LDPLT VKAR NN G+ASAL+QHEWRPKS
Sbjct:    3 GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNKNITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSNENSLTFGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKS 247          

HSP 2 Score: 25.7942 bits (55), Expect = 9.967e-93
Identity = 11/26 (42.31%), Postives = 17/26 (65.38%), Query Frame = 3
Query:  837 FTISGEGKPRAIEKREKIGLGLPPKP 914
            +TIS E   +AI+K  K+G+ +  KP
Sbjct:  249 WTISAEVDTKAIDKSSKVGIAVALKP 274          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC2_ARATH (Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana GN=HSR2 PE=1 SV=3)

HSP 1 Score: 328.561 bits (841), Expect = 2.887e-92
Identity = 161/250 (64.40%), Postives = 197/250 (78.80%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSF 837
            MVKGPGLY+EIGKKARDLLY+DYQ D KF+VTTY+S GVAIT++G  KG LFL DV+TQ+KN N T DVKV T+S+L TT+T DEPAPGLK I    +PD +SGK E+QY H+YAGIST +GFTA PI            +LGTD++++T +GNF   +AG ++T  DL ASL LNDKG+ LNASYY IVSP  +T VGAE++H+F++ EN +T+GTQHALDPLT+VKARVNN G A+ALIQHEWRPKSF
Sbjct:    1 MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSF 248          

HSP 2 Score: 32.7278 bits (73), Expect = 2.887e-92
Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  834 FFTISGEGKPRAIEKREKIGLGLPPKP 914
            FFT+SGE   +AI+K  K+G+ L  KP
Sbjct:  248 FFTVSGEVDSKAIDKSAKVGIALALKP 274          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC1_WHEAT (Mitochondrial outer membrane porin OS=Triticum aestivum GN=VDAC1 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.170e-88
Identity = 162/247 (65.59%), Postives = 195/247 (78.95%), Query Frame = 1
Query:   97 GPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDE-PAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKS 834
            GPGLYS IGKKA+DLLY+DYQ+DHKFT+TTYT+ G AIT++  KK +L + ++ +Q+KNKNIT DVK ++ SN+ TTIT D+  APGLK+I SF VPDQ+SGKVELQY H+YAGI+  IG TANP+            A+G D+S DTAT NF K +A LSYT+ DLIASL LN+KGD+L ASYYHIV   + TAVGAELTHSFSSNEN+LT GTQH LDPLT VKAR+NN G+ASALIQHE+ PKS
Sbjct:    3 GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQIKNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFSSNENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKS 248          

HSP 2 Score: 26.9498 bits (58), Expect = 3.170e-88
Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 3
Query:  840 TISGEGKPRAIEKREKIGLGLPPKP 914
            TIS E   +AIEK  K+G+ +  KP
Sbjct:  251 TISAEVDTKAIEKSSKVGIAIALKP 275          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC_MAIZE (Outer plastidial membrane protein porin OS=Zea mays GN=POR1 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 6.469e-80
Identity = 145/252 (57.54%), Postives = 184/252 (73.02%), Query Frame = 1
Query:   88 MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDE-PAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSFL 840
            MV   GLY++IGKK RDLLYKDY +  KF +TT +  GVAIT++G +K E    ++ TQ+KNK +T DVK ++ S+L TTITVDE   PGLKSI + +VPDQRSGK+E QY HEYAG++  +G  +NP+            ++G D+SFDTAT +FTK +A LS T  DLIASL LN+ GDTL ASYYH+V   + TAVGAEL+HS S NE+TL  G+QH+LDP T++K R NNYG ASAL+QHEWRPKSF+
Sbjct:    1 MVVAVGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFV 252          

HSP 2 Score: 28.1054 bits (61), Expect = 6.469e-80
Identity = 13/23 (56.52%), Postives = 16/23 (69.57%), Query Frame = 3
Query:  834 FFTISGEGKPRAIEKREKIGLGL 902
            F TISG+   +AIEK  K+GL L
Sbjct:  251 FVTISGDVDTKAIEKSTKVGLSL 273          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC_DROME (Voltage-dependent anion-selective channel OS=Drosophila melanogaster GN=porin PE=1 SV=3)

HSP 1 Score: 79.7221 bits (195), Expect = 3.661e-14
Identity = 67/252 (26.59%), Postives = 115/252 (45.63%), Query Frame = 1
Query:  100 PGLYSEIGKKARDLLYKDYQSD-HKFTVTTYTSAGVAITSSG---VKKGELF-LADVSTQLKNKNITTDVKVDTNSNLFTTITV-DEPAPGLK-SIFSFIVPD--QRSGKVELQYQHEYAGISTGIGF-TANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWR 825
            P  YS++GK+ARD+  K Y     K  + T TS+G+   ++G    + G++F   +   ++K+  +T   K +T++ LFT + V D+   GLK S+     P    ++GK ++ Y HE     + +      P+              G   +FDT     T  +  L YT  D +    +ND G   + S +   S   +  VG +L+ +  ++     IG ++ LD   SV+A+VNN  +     Q + R
Sbjct:    3 PPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVND-GQEFSGSIFQRTSDKLD--VGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLR 251          
BLAST of DY257712 vs. ExPASy Swiss-Prot
Match: VDAC2_XENLA (Voltage-dependent anion-selective channel protein 2 OS=Xenopus laevis GN=vdac2 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.661e-14
Identity = 69/239 (28.87%), Postives = 104/239 (43.51%), Query Frame = 1
Query:  100 PGLYSEIGKKARDLLYKDYQSD-HKFTVTTYTSAGVAITSSGVKKGELFLADVSTQLKNK----NITTDVKVDTNSNLFTTITV-DEPAPGLKSIFSFIV---PDQRSGKVELQYQHEYAGISTGIGFT-ANPIXXXXXXXXXXXXALGTDLSFDTATGNFTKCSAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSNENTLTIGTQHALDPLTSVKARVNN 786
            P  Y+++GK ARD+  K Y     K  V T ++ GV  T+SG    +    + S + K K     +T   K +T++ L T I + D+ A GLK  F         ++SGKV+  Y+ EY  +   + F  A P               G  ++FD+A    TK +  + Y   D      +ND G     S Y  VS    TAV   L  +  +N     I  ++ LD   ++ A+VNN
Sbjct:    3 PPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFTTSGTSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKQEYVNLGCDVDFDFAGPAIHGSAVVGYEGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVND-GSEFAGSIYQKVSDKMETAV--NLAWTSGNNSTRFGIAAKYQLDSHAAISAKVNN 238          
The following BLAST results are available for this feature:
BLAST of DY257712 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
VDAC2_SOLTU2.261e-11880.47Mitochondrial outer membrane protein porin of 36 k... [more]
VDAC1_SOLTU2.328e-10974.22Mitochondrial outer membrane protein porin of 34 k... [more]
VDAC_PEA9.004e-10068.92Outer plastidial membrane protein porin OS=Pisum s... [more]
VDAC1_ARATH9.859e-9969.60Mitochondrial outer membrane protein porin 1 OS=Ar... [more]
VDAC1_ORYSJ9.967e-9367.48Mitochondrial outer membrane protein porin OS=Oryz... [more]
VDAC2_ARATH2.887e-9264.40Mitochondrial outer membrane protein porin 2 OS=Ar... [more]
VDAC1_WHEAT3.170e-8865.59Mitochondrial outer membrane porin OS=Triticum aes... [more]
VDAC_MAIZE6.469e-8057.54Outer plastidial membrane protein porin OS=Zea may... [more]
VDAC_DROME3.661e-1426.59Voltage-dependent anion-selective channel OS=Droso... [more]
VDAC2_XENLA3.661e-1428.87Voltage-dependent anion-selective channel protein ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AB05ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257712 ID=DY257712|Name=DY257712|organism=Citrus clementina|type=EST|length=1181bp
GGGGTTTTGATTTCATAATCTTCCTCCAGCTGAAATAATCAAAACTGATA
TTTCTCAGCGTTTCCTTTCCATTTTCTCTGGAGAATCATGGTGAAAGGCC
CCGGGCTCTACTCTGAAATCGGCAAGAAAGCCCGAGATCTTCTCTACAAG
GACTACCAGAGCGACCACAAGTTCACTGTCACTACTTACACGTCAGCTGG
AGTCGCGATAACTTCGAGTGGTGTTAAGAAAGGTGAGCTTTTTTTGGCTG
ATGTCAGCACTCAGTTGAAGAACAAGAACATCACTACTGATGTTAAAGTT
GATACTAACTCTAATCTTTTTACAACCATCACTGTCGATGAGCCTGCTCC
TGGACTCAAGTCAATCTTTAGCTTTATCGTTCCTGATCAGAGATCTGGCA
AGGTGGAACTCCAATATCAGCATGAATATGCTGGAATAAGCACTGGCATT
GGATTCACTGCAAATCCCATTGTTAACTTTTCTGGTGTGGTTGGAAACAA
TTCTGTTGCTCTTGGGACTGATCTCTCATTTGATACTGCCACTGGCAACT
TCACCAAGTGCAGTGCGGGGCTGAGCTATACACATATTGACCTCATTGCT
TCCCTGACATTGAATGACAAAGGTGACACCCTTAATGCTTCCTACTACCA
CATTGTAAGCCCACTGACCAATACCGCTGTTGGGGCGGAGCTGACCCATA
GCTTTTCAAGCAACGAGAACACTCTGACAATCGGAACTCAACATGCTCTT
GATCCTTTGACCTCGGTGAAAGCCCGTGTGAACAACTATGGCAGGGCAAG
TGCTCTTATCCAGCACGAGTGGCGTCCCAAATCTTTTTTACTATCTCAGG
AGAAGGAAAACCCCGGGCCATTGAAAAAAGGGAAAAAATTGGGCTGGGGT
TACCTCCCAAGCCAAAAGCCAAACAATTAACCTTGGGCGTCGGGGGGGAA
AGGAAAAAAAAATGTTTTTAAATGGGGGGAATAAATTAATTGTTTAAAAA
AAATGAGGGGAAAACCCAAATTTTCTTTCTTTTTTTTTTCCCCTTTCCCA
AAAACTTTGGAATTCCCCCCCGGGGGGGGTTTTGTGGGTTTCCAAAAGTG
TGGTGGCCCCGGGGGTTGAAAAAAAAATTTTCCGGCTTGAATTGCCCAAA
AACCCAAATTTGGGGTGTTTTTCTTCTTTTT
back to top