DY257715

Overview
NameDY257715
Unique NameDY257715
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1335
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY257715_ssr1322 microsatellite DY257715_ssr1322:1322..1333. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9888 contig Ccv1_Contig9888:4..1338. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: ALKB8_XENTR (Alkylated DNA repair protein alkB homolog 8 OS=Xenopus tropicalis GN=alkbh8 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 1.984e-43
Identity = 84/148 (56.76%), Postives = 108/148 (72.97%), Query Frame = 3
Query:  213 LEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDKSLVTKW 656
            LE++YVH+VYD IA HFSSTR   WPK+  FL SLP GSLV D GCGNGKYLG+N D   IGCD S +L+ IC +R  E  V DA+++P+R+   DA ISIAV+HH +TE RR  A++EL+R+++KG   LI VWA+EQE K   +K+
Sbjct:  369 LEREYVHKVYDDIAGHFSSTRHTPWPKIGDFLASLPKGSLVADVGCGNGKYLGVNKDLCMIGCDRSKNLVDICRERTFEAFVCDALSVPFRAGAFDACISIAVIHHFATEERRIAALQELIRLLRKGGKALIYVWALEQEYKKNKSKY 516          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: ALKB8_MOUSE (Alkylated DNA repair protein alkB homolog 8 OS=Mus musculus GN=Alkbh8 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 7.538e-43
Identity = 83/157 (52.87%), Postives = 113/157 (71.97%), Query Frame = 3
Query:  186 SSSIKSTPELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDKSLVTKW 656
            + S K   ELE+K+VH+VY+ IA HFSSTR + WP++  FL +LPSGS+V D GCGNGKYLG+N D + IGCD S +L+ IC +R  + LV DA+ +P RS   DA ISIAV+HH +T  RR +A++EL R+++ G   LI VWA+EQE K+  +K+
Sbjct:  361 TESSKEALELEQKHVHQVYNEIASHFSSTRHSPWPRIVEFLKALPSGSIVADIGCGNGKYLGINKDLYMIGCDRSQNLVDICRERQFQALVCDALAVPVRSGSCDACISIAVIHHFATAERRVEALQELARLLRPGGQALIYVWAMEQEYKNQKSKY 517          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: ALKB8_BOVIN (Alkylated DNA repair protein alkB homolog 8 OS=Bos taurus GN=ALKBH8 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.857e-41
Identity = 95/205 (46.34%), Postives = 124/205 (60.49%), Query Frame = 3
Query:  192 SIKSTPELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQE---DKSLVTKWTPLTQKYVEEWIGPGS---------PRV-RSPSARTLESIPETEDNG 767
            S K   +LE+ YVHRVY+ IA HFSSTR   WP +  FL +LPSGSLV D GCGNGKYLG+N + + IGCD S +L+ IC +R ++  V DA+ +P RS   DA ISIAV+HH +T  RR  A++ELVR+++ G   LI VWA+EQE    KS   +    +Q   EE     S         P V    SA ++ SI + +D G
Sbjct:  363 SDKEALQLEQDYVHRVYEEIARHFSSTRHTPWPHIVEFLKALPSGSLVADIGCGNGKYLGINNELYMIGCDHSQNLVDICRERQYQAFVCDALAVPIRSGSCDACISIAVIHHFATAERRVAALQELVRLLRPGGKALIYVWAMEQEYNKKKSKYLRENRTSQGMKEEISNDASVQELLVKQLPNVGNQDSAHSVSSINDFQDGG 567          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: ALKB8_HUMAN (Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens GN=ALKBH8 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 2.053e-40
Identity = 95/218 (43.58%), Postives = 130/218 (59.63%), Query Frame = 3
Query:  192 SIKSTPELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQE---DKSLVTKWTPLTQKYVEEWIGPGS------PRVRSPSAR-TLESIPETEDNGSEEQGKDPKQSVPDKL 815
            S K    LE++YVH+VY+ IA HFSSTR   WP +  FL +LPSGS+V D GCGNGKYLG+N + + IGCD S +L+ IC +R  +  V DA+ +P RS   DA ISIAV+HH +T  RR  A++E+VR+++ G   LI VWA+EQE    KS   +    +Q   EE     S       ++R   +R +  S+P   D  S+E G + +Q    KL
Sbjct:  363 SDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKYLGINKELYMIGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLRGNRNSQGKKEEMNSDTSVQRSLVEQMRDMGSRDSASSVPRIND--SQEGGCNSRQVSNSKL 578          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: ALKB8_MACFA (Alkylated DNA repair protein alkB homolog 8 OS=Macaca fascicularis GN=ALKBH8 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.331e-39
Identity = 77/155 (49.68%), Postives = 106/155 (68.39%), Query Frame = 3
Query:  192 SIKSTPELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDKSLVTKW 656
            S +    LE++YVH+VY+ IA HFSSTR   WP +  FL +LPSGS+V D GCGNGKYLG+N + + +GCD S +L+ IC +R  +  V DA+ +P RS   DA ISIAV+HH +T  RR  A++E+VR+++ G   LI VWA+EQE     +K+
Sbjct:  363 SDEEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKYLGVNKELYMVGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKY 517          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: TRM9_YEAST (tRNA (uracil-5-)-methyltransferase TRM9 OS=Saccharomyces cerevisiae GN=TRM9 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.683e-34
Identity = 88/215 (40.93%), Postives = 126/215 (58.60%), Query Frame = 3
Query:  195 IKSTPELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICA---DRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDKSLVTKWTPLTQKYVEEWIGPGS---PRVRS-PSAR-------TLESIPETEDNGSEEQGKDPKQ 797
            I    E E++YVH+VY+ IAPHFS TR+  WP V  FL + P GS+ +D GCGNGKYLG+NPD + IG D S  LI+ CA   +  + +LVAD +NLP++++  D AISIAV+HH ST  RR + I  ++  +++G   LI  WA+EQ   S       + Q     W+ P S   P+ +S P A+        L +IP  E +   ++ K+ +Q
Sbjct:    3 INQAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGIDVGCGNGKYLGVNPDIYIIGSDRSDGLIE-CARGINPSYNLLVADGLNLPHKNETFDFAISIAVVHHWSTRERRVEVIRHVLSKLRQGGQALIYCWALEQ-GSSRRGYHEGMEQDVFVPWVLPKSKSKPKTKSTPPAKVKTRPKPNLMNIPPKERSEYLQRWKEEQQ 215          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: K1456_MOUSE (Putative methyltransferase KIAA1456 OS=Mus musculus GN=Kiaa1456 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.146e-33
Identity = 68/143 (47.55%), Postives = 95/143 (66.43%), Query Frame = 3
Query:  210 ELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDK 638
            ELEK++VH VY+  AP+F+  +   WP+V  FL     GSLV D GCG GKYL +N     +GCD    L++I  +RG EV+V D +NLP+R    DA ISI V+HH ST+ RR +AI+E+ RV+  G  ++I VWA+EQ+++
Sbjct:    7 ELEKRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPGSLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDAIISIGVIHHFSTKERRIRAIKEMARVLAPGGQLMIYVWAMEQKNR 149          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: K1456_HUMAN (Putative methyltransferase KIAA1456 OS=Homo sapiens GN=C8orf79 PE=2 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 4.146e-33
Identity = 66/143 (46.15%), Postives = 96/143 (67.13%), Query Frame = 3
Query:  210 ELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDK 638
            +LEK++VH VY++ AP+FS  +   WP+V  FL     GSL+ D GCG GKYL +N     +GCD    L++I  +RG E +V D +NLP+R +  DA ISI V+HH ST+ RR +AI+E+ RV+  G  ++I VWA+EQ+++
Sbjct:    7 QLEKQHVHNVYESTAPYFSDLQSKAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQVHTVGCDYCGPLVEIARNRGCEAMVCDNLNLPFRDEGFDAIISIGVIHHFSTKQRRIRAIKEMARVLVPGGQLMIYVWAMEQKNR 149          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: YAZ3_SCHPO (Uncharacterized protein C13D6.03c OS=Schizosaccharomyces pombe GN=SPAC13D6.03c PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.415e-33
Identity = 68/142 (47.89%), Postives = 100/142 (70.42%), Query Frame = 3
Query:  210 ELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQED 635
            E E +YVH+VYD IA HFS TR+  WP V  FL SLP GS+ +D GCGNGKY  +NP+ + IG D    L+KI ++ G  ++++D +++P+ S+  D A+SIAV+HH S E+RR +A++E++R + KG   L  VWA+EQ++
Sbjct:    4 EYENEYVHQVYDKIATHFSDTRYKPWPVVEKFLKSLPLGSVGVDIGCGNGKYQKVNPNVYMIGSDRCVKLVKIASNLG-PMVISDGLHVPHPSNRFDFALSIAVIHHFSNENRRLQAVQEVLRPLVKGGKALFFVWALEQKN 144          
BLAST of DY257715 vs. ExPASy Swiss-Prot
Match: K1456_BOVIN (Putative methyltransferase KIAA1456 homolog OS=Bos taurus PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.415e-33
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 3
Query:  210 ELEKKYVHRVYDAIAPHFSSTRFAKWPKVATFLNSLPSGSLVLDAGCGNGKYLGLNPDCFFIGCDISPSLIKICADRGHEVLVADAVNLPYRSDFGDAAISIAVLHHLSTESRRKKAIEELVRVVKKGSLVLITVWAVEQEDK 638
            +LEK++VH VY++ AP+FS  +   WP+V  FL     GSL+ D GCG GKYL +N     +GCD    L++I   RG EV+V D +NLP+R    DA ISI V+HH ST+ RR +AI+E+ RV+  G  ++I VWA+EQ+++
Sbjct:    7 QLEKQHVHDVYESTAPYFSDLQSKAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQVHTLGCDYCAPLVEIARSRGCEVMVCDNLNLPFRDQGFDAIISIGVIHHFSTKQRRIRAIKEMARVLVPGGQLMIYVWAMEQKNR 149          
The following BLAST results are available for this feature:
BLAST of DY257715 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
ALKB8_XENTR1.984e-4356.76Alkylated DNA repair protein alkB homolog 8 OS=Xen... [more]
ALKB8_MOUSE7.538e-4352.87Alkylated DNA repair protein alkB homolog 8 OS=Mus... [more]
ALKB8_BOVIN1.857e-4146.34Alkylated DNA repair protein alkB homolog 8 OS=Bos... [more]
ALKB8_HUMAN2.053e-4043.58Alkylated DNA repair protein alkB homolog 8 OS=Hom... [more]
ALKB8_MACFA1.331e-3949.68Alkylated DNA repair protein alkB homolog 8 OS=Mac... [more]
TRM9_YEAST1.683e-3440.93tRNA (uracil-5-)-methyltransferase TRM9 OS=Sacchar... [more]
K1456_MOUSE4.146e-3347.55Putative methyltransferase KIAA1456 OS=Mus musculu... [more]
K1456_HUMAN4.146e-3346.15Putative methyltransferase KIAA1456 OS=Homo sapien... [more]
YAZ3_SCHPO5.415e-3347.89Uncharacterized protein C13D6.03c OS=Schizosacchar... [more]
K1456_BOVIN5.415e-3346.85Putative methyltransferase KIAA1456 homolog OS=Bos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AC04ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257715 ID=DY257715|Name=DY257715|organism=Citrus clementina|type=EST|length=1335bp
GATCTCCGTACAGTACACCTTCTGTTGTAACCCTAAGCCTAATCGCTGAG
ATGTGAACTGAATCAGGAATTTCTGGAACTATGAGAGAAGTTAAAGTAAA
AGGTGCTTCTGATTTTTGTACCCTTGGAGCTGATGGAGAATCTAGCATTC
ATTCTGTATCTACAGGGGAGGACCAGCGATGCTCATCCTCAAGCATAAAA
TCTACTCCTGAATTAGAAAAGAAGTATGTCCATCGTGTTTATGATGCCAT
AGCTCCCCATTTCAGTTCCACTCGTTTCGCTAAGTGGCCAAAAGTTGCCA
CTTTTTTGAATTCTTTGCCTTCAGGGTCTCTTGTCTTGGATGCAGGATGT
GGAAATGGGAAGTATTTGGGTTTAAATCCGGATTGCTTCTTCATCGGTTG
TGATATTAGTCCTTCCTTAATTAAAATTTGTGCGGACAGGGGGCATGAAG
TTTTGGTTGCAGATGCTGTAAATCTCCCCTACAGATCTGATTTTGGCGAT
GCAGCCATCTCTATAGCCGTATTACATCATCTGAGCACTGAAAGCAGGAG
AAAGAAAGCAATTGAAGAATTAGTTAGGGTTGTCAAAAAGGGTAGCTTAG
TTCTAATAACAGTCTGGGCAGTGGAACAAGAGGATAAATCATTAGTTACC
AAATGGACTCCTCTTACTCAAAAGTATGTGGAAGAGTGGATAGGACCTGG
GAGTCCTCGAGTTCGTAGCCCTTCAGCTCGAACGTTAGAAAGCATCCCAG
AAACCGAGGATAATGGTTCTGAAGAGCAAGGAAAAGACCCAAAGCAAAGT
GTACCTGATAAGTTGTTGAGAATCTATAATTTTAACTTCTCAAAGTGAAG
ATGATTCAGTGATTTCTCAAGATGTGAAAATTTATCCCAAATCAACAGGA
AATATTTTTGTCCCTTTGGCACTTACCTTTACCCCCGTGCTAAAGTCAAG
TGGGGCATCCTGCTTGTGCTTCTTGCAAATGGGCCCAAGCAAAAAAAAAA
GAAAAAAAAGGGGGGCTGTAAGTGTAACAACCAAAAATTCCCATGTTCTT
TCTGGGGAAGGGGGAAACTTTGAAGAAAATTGGCCTTTTGAAAATCTCCA
CAATGGCATAAAATAATTTTTAATCTCATTTTTTTTAAAAAAAATCAAAT
TTGGGGGGCTTTTGTTTTTTTTCAAAAAAAAAACTTTTCTGGAAAAAAAA
TCCAATTTTTGGTTGTTTTTTAACCCGCGTGAAAACCAAAAATATTTTCT
ACAAAATTTGAAAAACCCCCCCCCCCTTATAGGGGGAAAAAACAAAAAAA
ATATTTTTTATTTATATATTTTTTGTTTGTTTGTT
back to top