DY257728

Overview
NameDY257728
Unique NameDY257728
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1193
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14972 contig Ccv1_Contig14972:203..1395. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK2_ARATH (Inositol-tetrakisphosphate 1-kinase 2 OS=Arabidopsis thaliana GN=ITPK2 PE=2 SV=2)

HSP 1 Score: 359.377 bits (921), Expect = 7.640e-106
Identity = 180/217 (82.95%), Postives = 199/217 (91.71%), Query Frame = 2
Query:  140 KLVVVGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSLPDVTKQDLSTSAGVFRFPR 790
            K ++VGYALTSKK KSFLQPKLEGLARNKGILFVAIDQN+PLS+QGPFDIVLHK  GKEWR+ILEE+R  HP+VTVLDPP AI HL NRQSMLQCVADMNLS+S G+V VP+QLVI++DASSIP+ V  AGL LPLVAKPLVADGSAKSHELSLAYDQ+SL KLEPPLVLQEFVNHGGVLFKVYIVGEAI+VVRRFSLPDV++++L  SAGVFRFPR
Sbjct:   39 KSIIVGYALTSKKIKSFLQPKLEGLARNKGILFVAIDQNKPLSEQGPFDIVLHKQIGKEWRRILEEFRLAHPDVTVLDPPDAILHLRNRQSMLQCVADMNLSDSNGRVGVPKQLVIKKDASSIPEAVNNAGLRLPLVAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHGGVLFKVYIVGEAIRVVRRFSLPDVSRRELPKSAGVFRFPR 255          

HSP 2 Score: 44.669 bits (104), Expect = 7.640e-106
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  783 FHGVSCXXXXXXXXXXXPCVAELPPRPLIKRTAKEPSSSTGFSGCSIWEIIRKKWEPGNQFFCPLTLTYFPGVWGKRPE 1019
            F  VSC           P +AELPPRPL++R AKE     G    ++ +IIR+        F  + + YFPG +GK PE
Sbjct:  253 FPRVSCAAASADDADLDPSIAELPPRPLLERLAKELRRGLGLRLFNL-DIIRE--HGTRDRFYVIDINYFPG-YGKMPE 327          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK3_ARATH (Inositol-tetrakisphosphate 1-kinase 3 OS=Arabidopsis thaliana GN=ITPK3 PE=2 SV=3)

HSP 1 Score: 297.36 bits (760), Expect = 1.032e-84
Identity = 147/221 (66.52%), Postives = 185/221 (83.71%), Query Frame = 2
Query:  128 QQQSKLVVVGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSLPDVTKQDLSTSAGVFRFPR 790
            QQQ KLVV GYALTSKK KSFLQPKLE LAR KGI FVAID NRPLS+QGPFD+VLHKL GKEW +++E+Y+Q HPEVTVLDPP +IQ ++NRQSMLQ +AD+ LS+  G + VP+Q+V+ +D+++  D V++AGL  PLVAKPL  DG+AKSH+L LAYD+ SL +L+PPLVLQEFVNHGGV+FKV++VG+ IKV+RRFSLP+V+  + +   GVF+FPR
Sbjct:   76 QQQQKLVV-GYALTSKKKKSFLQPKLELLARRKGIFFVAIDLNRPLSEQGPFDVVLHKLLGKEWEEVIEDYQQKHPEVTVLDPPGSIQRIYNRQSMLQGMADLKLSDCSGSLFVPKQMVVLKDSAASADAVVEAGLKFPLVAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHGGVMFKVFVVGDVIKVMRRFSLPNVSNCEKAKVDGVFQFPR 295          

HSP 2 Score: 36.1946 bits (82), Expect = 1.032e-84
Identity = 26/74 (35.14%), Postives = 38/74 (51.35%), Query Frame = 3
Query:  834 PCVAELPPRPLIKRTAKEPSSSTGFSGCSIWEIIRKKWEPGNQFFCPLTLTYFPGVWGKRPEISNP*FIRTFSN 1055
            P VAELPP+P ++   KE  S  G    +I ++IR+        F  + + YFPG +GK P+     F+  F N
Sbjct:  310 PRVAELPPKPFLEALVKELRSLLGLRLFNI-DMIRE--HGSKNVFYVIDINYFPG-YGKLPDYEQV-FVDFFQN 378          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_MAIZE (Inositol-tetrakisphosphate 1-kinase 1 OS=Zea mays GN=ITPK1 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 2.380e-53
Identity = 105/213 (49.30%), Postives = 150/213 (70.42%), Query Frame = 2
Query:  149 VVGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMN-LSNSYGKVDVPRQLVIERDASSIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSLPDVTKQDLSTSAGVFRF 784
            V+GYAL  KK +SF+QP L   A ++G+  V +D ++PL++QGPF +++HKL G +WR  L  +   HP V ++DPP+AI  LHNR SMLQ V++++  ++      +P Q+V+  DA+++ D  L A L  PL+AKPLVADG+AKSH++SL Y +  L KL PPLVLQEFVNHGGV+FKVY+VG  +  V+R SLPDV+ +D +++ G   F
Sbjct:   20 VIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQLVAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVY-DAAALADFGLLAALRFPLIAKPLVADGTAKSHKMSLVYHREGLGKLRPPLVLQEFVNHGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSF 231          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_ARATH (Inositol-tetrakisphosphate 1-kinase 1 OS=Arabidopsis thaliana GN=ITPK1 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.680e-46
Identity = 98/213 (46.01%), Postives = 139/213 (65.26%), Query Frame = 2
Query:  149 VVGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYG-KVDVPRQLVIERDASSIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSLPDVTKQDLSTSAGVFRF 784
            +VGYAL +KK  SF+QP L   +R +GI  V +D  + L +QG  D ++HKL    W++ L E+R+  P V V+D P AI+ LHNR SML+ +  +    S   +  VP Q+V+  D+S +        L  P++AKPL ADGSAKSH++ L YDQ  +K L+ P+VLQEFVNHGGV+FKVY+VG+ +K V+R SLPD++++ + TS G   F
Sbjct:   10 LVGYALAAKKQHSFIQPSLIEHSRQRGIDLVKLDPTKSLLEQGKLDCIIHKLYDVYWKENLHEFREKCPGVPVIDLPEAIERLHNRVSMLEVITQLRFPVSDSERFGVPEQVVV-MDSSVLSGGGALGELKFPVIAKPLDADGSAKSHKMFLIYDQEGMKILKAPIVLQEFVNHGGVIFKVYVVGDHVKCVKRRSLPDISEEKIGTSKGSLPF 221          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_DANRE (Inositol-tetrakisphosphate 1-kinase OS=Danio rerio GN=itpk1 PE=2 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 1.315e-27
Identity = 71/207 (34.30%), Postives = 114/207 (55.07%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWR------------QILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDAS-SIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY L+ KK K         L R +GI  + +D ++P+  QGPFD+++HKLT                 Q +++Y   HPE  +LDP  AI+ L +R    + +  +  S    ++  P  +V++ +      + + K G+T P + KP VA G+  SHE+++ + +  LK ++PP VLQ F+NH  VL+KV++VGEA  VV+R S+
Sbjct:   10 VGYWLSEKKIKKLNFQTFVDLCRKQGIEMIQLDLSQPIESQGPFDVIIHKLTDHIVDADQNVTESLLLVQGVQDYIDAHPETVILDPLPAIRTLLDRCKSYKLIHKLEHSMEDDRICSPPFMVLKTECGFETLEQLHKHGITFPFICKPQVAHGT-NSHEMAIIFSEEDLKDIKPPCVLQSFINHNAVLYKVFVVGEAYSVVQRPSI 215          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_CHICK (Inositol-tetrakisphosphate 1-kinase OS=Gallus gallus GN=ITPK1 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 5.525e-26
Identity = 69/207 (33.33%), Postives = 107/207 (51.69%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLT------------GKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIP-DVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY L+ KK +         L R +G+  V +D  +P+ DQGP D+++HKLT              E  Q  +EY   HPE  +LDP  AI+ L +R    + +  +       ++  P  + +          ++ K GL  P + K  VA G+  SHE+++ ++Q  LK + PP V+Q F+NH  VL+KV++VGE+  VV+R SL
Sbjct:   10 VGYWLSEKKIRKLNFQAFAELCRKRGVEVVQLDLTKPIEDQGPLDVIIHKLTDVILEADQNDSQSLELVQRFQEYIDAHPETIILDPLPAIRTLLDRSKSYELIRQIEAYMQDERICSPPFMELTSACGEDTLQLIEKNGLAFPFICKTRVAHGT-NSHEMAIIFNQEGLKAVRPPCVIQSFINHNAVLYKVFVVGESYTVVKRPSL 215          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_XENLA (Inositol-tetrakisphosphate 1-kinase OS=Xenopus laevis GN=itpk1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 7.978e-25
Identity = 69/208 (33.17%), Postives = 112/208 (53.85%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLT------------GKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVP--RQLVIERDASSIPDVVLKAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY ++ KK K         L R +GI  V ++  +P+ DQGP D+++HKLT              +  Q  ++Y + HPE  +LDP  AI+ L +R    + +  +       ++  P   +L+ E D  ++  ++ K GL  PLV K  VA G+  SHE+++ ++   L  ++PP V+Q F++H  VL+KV++VGE+  VV R SL
Sbjct:   10 VGYWMSEKKIKKLNFQAFADLCRKRGIEVVQLNLAKPIEDQGPLDVIIHKLTDVILEADQKDSESMQLVQRFQDYIEAHPETIILDPLPAIRTLLDRSKSYELIRRIETYMQDERICSPPFMELMAECDEDTLK-ILEKNGLAFPLVCKTRVAHGT-NSHEMAIIFNPEGLWSIKPPCVIQSFISHNAVLYKVFVVGESYTVVERPSL 215          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_HUMAN (Inositol-tetrakisphosphate 1-kinase OS=Homo sapiens GN=ITPK1 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 7.978e-25
Identity = 70/207 (33.82%), Postives = 108/207 (52.17%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLT------------GKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIPDVVL-KAGLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY L+ KK K         L R +G+  V ++ +RP+ +QGP D+++HKLT              E     +EY   HPE  VLDP  AI+ L +R    + +  +       ++  P  + +          +L K GLT P + K  VA G+  SHE+++ ++Q  L  ++PP V+Q F+NH  VL+KV++VGE+  VV+R SL
Sbjct:   10 VGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGT-NSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSL 215          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_MOUSE (Inositol-tetrakisphosphate 1-kinase OS=Mus musculus GN=Itpk1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.321e-24
Identity = 69/207 (33.33%), Postives = 107/207 (51.69%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLT------------GKEWRQILEEYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIPDVVLKA-GLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY L+ KK K         L R +GI  V ++ +RP+ +QGP D+++HKLT              E     +EY   HPE  VLDP  AI+ L +R    + +  +       ++  P  + +          +L+  GL  P + K  VA G+  SHE+++ ++Q  L  ++PP V+Q F+NH  VL+KV++VGE+  VV+R SL
Sbjct:   10 VGYWLSEKKVKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMKDDRICSPPFMELTSLCGEDTMRLLEQNGLAFPFICKTRVAHGT-NSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSL 215          
BLAST of DY257728 vs. ExPASy Swiss-Prot
Match: ITPK1_BOVIN (Inositol-tetrakisphosphate 1-kinase OS=Bos taurus GN=ITPK1 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.031e-24
Identity = 71/207 (34.30%), Postives = 109/207 (52.66%), Query Frame = 2
Query:  152 VGYALTSKKTKSFLQPKLEGLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTG------KEWRQILE------EYRQTHPEVTVLDPPYAIQHLHNRQSMLQCVADMNLSNSYGKVDVPRQLVIERDASSIPDVVLKA-GLTLPLVAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSL 733
            VGY L+ KK K         L R +GI  V ++ +RP+ +QGP D+++HKLT       +   Q LE      EY   HPE  VLDP  AI+ L +R    + +  +       ++  P  + +          +L+  GL  P + K  VA G+  SHE+++ ++Q  L  ++PP V+Q F+NH  VL+KV++VGE+  VV+R SL
Sbjct:   10 VGYWLSEKKIKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQALELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMKDDRICSPPFMELTSLCGDDTMRLLEENGLAFPFICKTRVAHGT-NSHEMAIVFNQEGLSAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSL 215          
The following BLAST results are available for this feature:
BLAST of DY257728 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
ITPK2_ARATH7.640e-10682.95Inositol-tetrakisphosphate 1-kinase 2 OS=Arabidops... [more]
ITPK3_ARATH1.032e-8466.52Inositol-tetrakisphosphate 1-kinase 3 OS=Arabidops... [more]
ITPK1_MAIZE2.380e-5349.30Inositol-tetrakisphosphate 1-kinase 1 OS=Zea mays ... [more]
ITPK1_ARATH3.680e-4646.01Inositol-tetrakisphosphate 1-kinase 1 OS=Arabidops... [more]
ITPK1_DANRE1.315e-2734.30Inositol-tetrakisphosphate 1-kinase OS=Danio rerio... [more]
ITPK1_CHICK5.525e-2633.33Inositol-tetrakisphosphate 1-kinase OS=Gallus gall... [more]
ITPK1_XENLA7.978e-2533.17Inositol-tetrakisphosphate 1-kinase OS=Xenopus lae... [more]
ITPK1_HUMAN7.978e-2533.82Inositol-tetrakisphosphate 1-kinase OS=Homo sapien... [more]
ITPK1_MOUSE2.321e-2433.33Inositol-tetrakisphosphate 1-kinase OS=Mus musculu... [more]
ITPK1_BOVIN3.031e-2434.30Inositol-tetrakisphosphate 1-kinase OS=Bos taurus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AE05ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257728 ID=DY257728|Name=DY257728|organism=Citrus clementina|type=EST|length=1193bp
GGGTTTGGTCTAGTTTTATAAAACCAAAATTAAATTTAAAAAATAAAAGG
GAAGAGAAATGAGGATGATGAAGGAGGAAATTGAAGAGCAAACTAGAGAG
GAGGAATTACTCTCGTTTCCTCAAACTCAGCAGCAATCCAAATTAGTTGT
TGTTGGTTACGCTCTTACCTCCAAGAAAACTAAAAGCTTCTTGCAGCCTA
AGCTTGAAGGCTTGGCTAGGAATAAGGGAATATTATTTGTTGCGATTGAC
CAGAACCGACCACTTTCAGATCAGGGCCCTTTTGACATTGTGCTGCATAA
GTTAACCGGGAAAGAGTGGCGCCAGATTCTCGAGGAATACAGGCAAACAC
ATCCAGAAGTCACAGTTCTTGATCCTCCATATGCTATTCAACACTTGCAC
AACCGTCAATCCATGCTTCAGTGTGTAGCTGATATGAATCTGTCTAACTC
CTATGGTAAAGTTGATGTTCCCAGACAATTAGTTATTGAAAGAGATGCAT
CATCGATCCCTGATGTGGTTTTGAAAGCTGGACTGACTCTACCCCTAGTT
GCAAAGCCGTTGGTTGCTGATGGGAGTGCAAAATCACATGAACTTTCACT
CGCTTATGATCAGTATTCCCTGAAGAAACTTGAACCTCCACTGGTTCTGC
AGGAATTTGTTAATCATGGAGGTGTTCTTTTTAAGGTTTATATTGTTGGG
GAAGCAATAAAAGTGGTCAGGAGATTCTCTTTACCTGATGTCACTAAACA
AGATCTCTCTACAAGTGCTGGTGTATTCCGTTTTCCACGGGGTGTCTTGT
GCTGCAGCTTCTGCAGATGATGCTGATTTGGACCCTTGTGTGGCTGAGCT
TCCTCCGCGACCTTTAATAAAGAGAACTGCCAAGGAACCTTCGTCGTCAA
CTGGGTTCTCGGGCTGTTCAATCTGGGAAATTATCCGAAAAAAATGGGAA
CCAGGAAATCAATTTTTTTGTCCTTTGACATTAACTTACTTCCCGGGGGT
TTGGGGAAAAAGGCCCGAAATATCAAACCCCTAATTTATCCGAACTTTTT
CTAATAAACCCCTGAAAACCAAACCCCGGGGAAACAAAAAAAAAATTCCC
TTGCTTAAAGTGGGAAGGGTTTTAAAAGGAAACTTTTTTTTTTTGGGGGG
TTAAAAAACACGGGGGGGGGGGGCCCACCCCCCCCCCTTCCCC
back to top