FC873241
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC873241 vs. ExPASy Swiss-Prot
Match: ARP4_ASPFU (Actin-related protein 4 OS=Aspergillus fumigatus GN=arp4 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.399e-11 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 55 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 177 ERK+ W+GGSILASL TF QMWISK EYDE GP+IV ++C Sbjct: 425 ERKFGSWVGGSILASLGTFHQMWISKKEYDEHGPNIVEKRC 465
BLAST of FC873241 vs. ExPASy Swiss-Prot
Match: ACTT1_RAT (Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.399e-11 Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 1 Query: 1 EITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 180 E+ LA IK+ A P+R YS WIGGS++ SL+TF+QMW++ ++ E G +V RKCF Sbjct: 317 ELEVLAFEGTPIKITASPDRCYSAWIGGSVMTSLTTFKQMWVTAEDFKEYGAFVVQRKCF 376
BLAST of FC873241 vs. ExPASy Swiss-Prot
Match: ACTT1_MACFA (Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.345e-11 Identity = 27/60 (45.00%), Postives = 41/60 (68.33%), Query Frame = 1 Query: 1 EITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 180 E+ LA IK+ A P+R +S WIG SI+ S+S+F+QMW++ ++ E G S+V R+CF Sbjct: 316 EVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 375
BLAST of FC873241 vs. ExPASy Swiss-Prot
Match: ACTT1_HUMAN (Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 5.345e-11 Identity = 27/60 (45.00%), Postives = 41/60 (68.33%), Query Frame = 1 Query: 1 EITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 180 E+ LA IK+ A P+R +S WIG SI+ S+S+F+QMW++ ++ E G S+V R+CF Sbjct: 317 EVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376
BLAST of FC873241 vs. ExPASy Swiss-Prot
Match: ACT_DICVI (Actin (Fragment) OS=Dictyocaulus viviparus PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.118e-11 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 85 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 180 SILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 33 The following BLAST results are available for this feature:
BLAST of FC873241 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 375
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC873241 ID=FC873241; Name=FC873241; organism=Citrus clementina; type=EST; length=556bpback to top |