FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5G_ARATH (Probable RING-H2 finger protein ATL5G OS=Arabidopsis thaliana GN=ATL5G PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.781e-14
Identity = 28/45 (62.22%), Postives = 40/45 (88.89%), Query Frame = 1
Query:  475 ECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRS 609
            +C+VCL+EFE++E+LRL+PKC+H FH  CID WL+SH+ CP+CR+
Sbjct:  141 DCSVCLSEFEENESLRLLPKCNHAFHLPCIDTWLKSHSNCPLCRA 185          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5K_ARATH (RING-H2 finger protein ATL5K OS=Arabidopsis thaliana GN=ATL5K PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.550e-14
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:  394 LDREVIDTFPTFV----YSDVKTLKVGKG-------ALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLA---SEPGETTPQPS 651
            LD  VI   P F     Y     +  G+G       + EC+VCL+EF+D+E LR+IP C H+FH +CID WL+++  CP+CR+ ++   S P +    PS
Sbjct:   99 LDESVIRAIPIFKFKKRYDQNDGVFTGEGEEEEEKRSQECSVCLSEFQDEEKLRIIPNCSHLFHIDCIDVWLQNNANCPLCRTRVSCDTSFPPDRVSAPS 198          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4F_ARATH (RING-H2 finger protein ATL4F OS=Arabidopsis thaliana GN=ATL4F PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.550e-14
Identity = 35/92 (38.04%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPG-ETTPQPSELGSS 666
            L +++ +  P  +Y +  T+       +C+VCL +++ +E L+ +P C H FH ECID WL SHTTCP+CR +L  +P  + + Q  E+ SS
Sbjct:   73 LSKDIREMLPIVIYKESFTVN----DTQCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTCPLCRLSLIPKPSVDLSHQSIEIVSS 160          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3A_ARATH (RING-H2 finger protein ATL3A OS=Arabidopsis thaliana GN=ATL3A PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 9.860e-14
Identity = 27/45 (60.00%), Postives = 40/45 (88.89%), Query Frame = 1
Query:  475 ECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRS 609
            +C+VCL+EF+++E+LRL+PKC+H FH  CID WL+SH+ CP+CR+
Sbjct:  158 DCSVCLSEFQENESLRLLPKCNHAFHVPCIDTWLKSHSNCPLCRA 202          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1G_ARATH (RING-H2 finger protein ATL1G OS=Arabidopsis thaliana GN=ATL1G PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.288e-13
Identity = 41/129 (31.78%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  292 FFSIYIRHCSDSSNSVIXXXXXXXXXXXXXXXXXLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL---ASEPGETTPQPSELGSSE 669
            F+ IY+R  S   +S+                  L +E+ +  P  V+ +  T+       +C+VCL +++ ++ L+ IP C H FH +CID WL SHTTCP+CR  L    S   +  P PS +   E
Sbjct:   42 FYLIYLRRSSSDLSSLGMRTTFIPGNSLSTIELGLSKELREMLPIVVFKESFTVMDS----QCSVCLGDYQPNDKLQQIPVCKHTFHMDCIDLWLTSHTTCPLCRLALIPSRSRQSQDDPVPSLVSPDE 166          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5M_ARATH (RING-H2 finger protein ATL5M OS=Arabidopsis thaliana GN=ATL5M PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.682e-13
Identity = 32/74 (43.24%), Postives = 49/74 (66.22%), Query Frame = 1
Query:  415 TFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGET 636
            T PT VYS    L++     ECA+CL+EFE  E+++++ KC H FH +CI  WL + ++CP CR+++ S+  ET
Sbjct:   88 TTPTLVYSS--DLELAGAEAECAICLSEFEQGESIQVLEKCQHGFHVKCIHKWLSTRSSCPTCRTSIFSQHSET 159          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3K_ARATH (RING-H2 finger protein ATL3K OS=Arabidopsis thaliana GN=ATL3K PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.747e-13
Identity = 36/96 (37.50%), Postives = 61/96 (63.54%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYS-DVKTLKVGKGALE-------CAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSEL 657
            LD  VI+++P F ++ D+  +  G G  +       C++CL E+ ++E LR++P+C H FH  C+DAWL+ + +CPVCR++    P ++TPQ + L
Sbjct:  100 LDHSVINSYPKFHFTKDITAVVNGDGFHDGEGRETTCSICLCEYMEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTP-QSTPQSTPL 194          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5E_ARATH (Putative RING-H2 finger protein ATL5E OS=Arabidopsis thaliana GN=ATL5E PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.391e-13
Identity = 34/90 (37.78%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSELGS 663
            LDR VI+++P  V  D + L        C++CL ++E  E +R IP+C+H FH +C+D WL +  TCP+CR+         +P PS L +
Sbjct:   67 LDRPVIESYPRIVLGDSRRLPRPNNG-PCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRN---------SPAPSRLAT 146          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5B_ARATH (RING-H2 finger protein ATL5B OS=Arabidopsis thaliana GN=ATL5B PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.391e-13
Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            + +  +   P   YS    +K    A EC +CL +F + ET+R++PKC+H FH +CID WL SH++CP CR +L
Sbjct:   89 IKKRALKVIPVDSYSPELKMK----ATECLICLGDFVEGETVRVLPKCNHGFHVKCIDTWLLSHSSCPTCRQSL 158          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2L_ARATH (RING-H2 finger protein ATL2L OS=Arabidopsis thaliana GN=ATL2L PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.391e-13
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSE 654
            L+  VI + PTF      T  V   A ECAVCL+  ++ +  R +P C H+FH +C+D WL + +TCPVCR+ +   P    P+P E
Sbjct:   82 LNPTVIASLPTFTVG--ATDGVAASATECAVCLSVLKEQDKARELPNCKHIFHVDCVDTWLTTCSTCPVCRTEVEPRP-RLEPEPRE 165          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
ATL5G_ARATH5.781e-1462.22Probable RING-H2 finger protein ATL5G OS=Arabidops... [more]
ATL5K_ARATH7.550e-1439.00RING-H2 finger protein ATL5K OS=Arabidopsis thalia... [more]
ATL4F_ARATH7.550e-1438.04RING-H2 finger protein ATL4F OS=Arabidopsis thalia... [more]
ATL3A_ARATH9.860e-1460.00RING-H2 finger protein ATL3A OS=Arabidopsis thalia... [more]
ATL1G_ARATH1.288e-1331.78RING-H2 finger protein ATL1G OS=Arabidopsis thalia... [more]
ATL5M_ARATH1.682e-1343.24RING-H2 finger protein ATL5M OS=Arabidopsis thalia... [more]
ATL3K_ARATH3.747e-1337.50RING-H2 finger protein ATL3K OS=Arabidopsis thalia... [more]
ATL5E_ARATH6.391e-1337.78Putative RING-H2 finger protein ATL5E OS=Arabidops... [more]
ATL5B_ARATH6.391e-1341.89RING-H2 finger protein ATL5B OS=Arabidopsis thalia... [more]
ATL2L_ARATH6.391e-1340.23RING-H2 finger protein ATL2L OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top