FC875271

Overview
NameFC875271
Unique NameFC875271
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10194 contig Ccv1_Contig10194:1..665. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_MOUSE (40S ribosomal protein S26 OS=Mus musculus GN=Rps26 PE=2 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_MACFA (40S ribosomal protein S26 OS=Macaca fascicularis GN=RPS26 PE=3 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_HUMAN (40S ribosomal protein S26 OS=Homo sapiens GN=RPS26 PE=1 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_BOVIN (40S ribosomal protein S26 OS=Bos taurus GN=RPS26 PE=3 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_SHEEP (40S ribosomal protein S26 OS=Ovis aries GN=RPS26 PE=3 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 1.633e-21
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEAGVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_BRUPA (40S ribosomal protein S26 (Fragment) OS=Brugia pahangi PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.132e-21
Identity = 45/64 (70.31%), Postives = 53/64 (82.81%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NCG+C PKDKAIK+F+VRNIV  AAVRD+ +A  YD Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VRPIRCTNCGRCAPKDKAIKKFVVRNIVVAAAVRDISDASAYDSYALPKLYHKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_SCHCO (40S ribosomal protein S26 OS=Schizophyllum commune GN=RPS26 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.785e-21
Identity = 44/65 (67.69%), Postives = 52/65 (80.00%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 306
            V F+RCSNC +C  KDKAIKRF VRN+VE AA+RD+ +A VY  Y +PKLY K+ YCVSCAIHSH
Sbjct:   18 VTFVRCSNCSRCVAKDKAIKRFTVRNMVESAAIRDISDASVYPEYAIPKLYIKIAYCVSCAIHSH 82          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_CRICR (40S ribosomal protein S26 OS=Cricetus cricetus GN=RPS26 PE=3 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 2.785e-21
Identity = 44/64 (68.75%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY ++ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVELHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26B_SCHPO (40S ribosomal protein S26-B OS=Schizosaccharomyces pombe GN=rps26b PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.750e-21
Identity = 44/64 (68.75%), Postives = 53/64 (82.81%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VKF+RC NC +  PKDKAIKR+ +RN+VE AA+RD+ EA VY  YT+PKLY K+QYCVSCAIHS
Sbjct:   18 VKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_NEUCR (40S ribosomal protein S26E OS=Neurospora crassa GN=rps-26 PE=3 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 8.103e-21
Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH 300
            VK IRCSNC +C PKDKAIKRF +RN+VE AA+RD+ +A V+  YT+PK+Y K+QYCVSCAIH
Sbjct:   18 VKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIH 80          
The following BLAST results are available for this feature:
BLAST of FC875271 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS26_MOUSE9.572e-2270.3140S ribosomal protein S26 OS=Mus musculus GN=Rps26... [more]
RS26_MACFA9.572e-2270.3140S ribosomal protein S26 OS=Macaca fascicularis G... [more]
RS26_HUMAN9.572e-2270.3140S ribosomal protein S26 OS=Homo sapiens GN=RPS26... [more]
RS26_BOVIN9.572e-2270.3140S ribosomal protein S26 OS=Bos taurus GN=RPS26 P... [more]
RS26_SHEEP1.633e-2170.3140S ribosomal protein S26 OS=Ovis aries GN=RPS26 P... [more]
RS26_BRUPA2.132e-2170.3140S ribosomal protein S26 (Fragment) OS=Brugia pah... [more]
RS26_SCHCO2.785e-2167.6940S ribosomal protein S26 OS=Schizophyllum commune... [more]
RS26_CRICR2.785e-2168.7540S ribosomal protein S26 OS=Cricetus cricetus GN=... [more]
RS26B_SCHPO4.750e-2168.7540S ribosomal protein S26-B OS=Schizosaccharomyces... [more]
RS26_NEUCR8.103e-2168.2540S ribosomal protein S26E OS=Neurospora crassa GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402B03EF CTVClemen1 Citrus clementina cDNA clone C31402B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875271 ID=FC875271|Name=FC875271|organism=Citrus clementina|type=EST|length=665bp
GGAACAACCCTGACCCTCTGAAACAACAAGCAGCAGCGGCGCAACAAAAA
CAACAACAAGATGACGTTCAAGCGGAGGAACGGAGGAAGGAACAAGCACG
GCCGTGGCCACGTCAAGTTCATCCGCTGCTCTAACTGCGGCAAATGCTGC
CCTAAGGACAAGGCGATTAAGAGGTTTTTGGTGAGGAACATTGTTGAGCA
AGCTGCTGTTAGGGATGTTCAGGAGGCGTGTGTTTATGACGGTTACACTC
TTCCTAAGTTATATGCTAAGATGCAGTACTGCGTCTCGTGTGCGATCCAC
TCTCATGTGGTGAGAGTTCGTTCCCGTACTAACAGGAGGATCCGTGAGCC
CCCGCAACGCTTCAGGCGCAGGGATGATGTCCCAAAGGCTGGTGGTGCTC
TTGGTCAAGGCCCACGAGCTGGTGGTCCAGCTGGAGCTCCAGCTGCTGCT
CGTGCTTGAAAGCTTTCTGCTGTCAGTGCTTCTGGTCCTTTGAGGCTTTT
GAGATTTTTATGTGGTGGTATCAGATATGTGGGTCTGTTTAATTAGAGCA
CTGCAAACTTTTATGTTAGTTTTGTGTTTTGTTGTCATGCATCAGAGAAC
TGTTTACTGTCAAAAGTTTGAATCAAAACCCTAGAGAATTTTGATGGAGT
GATTGAAGTAAAATT
back to top